PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010533837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family GeBP
Protein Properties Length: 397aa    MW: 43600.4 Da    PI: 4.9619
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010533837.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573135.71.6e-42169264297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqrlwse+Dei++L+G+idfk++tg+sp+ddi++fye +kksisf+vsk q+++Kir+L+kK+ ++  k k+g++psf k+h++k+felsk iW
  XP_010533837.1 169 YFQRLWSEDDEIAVLKGIIDFKSDTGVSPFDDINGFYELAKKSISFDVSKVQFMDKIRSLRKKYVNNLGKGKNGEDPSFVKAHERKAFELSKAIW 263
                     79********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  XP_010533837.1 264 G 264
                     9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.6E-34170264IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MSPKRPNPME DPPTASSSEE EEEVSMDEDE EEDETHKEKS SSDEEADDGD DREVSVKNPL  60
SASAKPGSAS AVTIAVPGKT VAPPKQASDS DSGSETETDS DSDTDRRERV AVKPVEQNPE  120
SVKAKPSDAL ASSAKSAVKR PSKTARPPND VKRVRKEGGT PGEDTKKTYF QRLWSEDDEI  180
AVLKGIIDFK SDTGVSPFDD INGFYELAKK SISFDVSKVQ FMDKIRSLRK KYVNNLGKGK  240
NGEDPSFVKA HERKAFELSK AIWGPEGMAN ESAMKSNGKS KKSQKGKMKS LESLKQELFP  300
SHNGKREELD AEEIASRLVS RSNGFETMLV KAMAGFGVDE LAVKQGWAMV SSEDKKRIEE  360
KWNALRAAEI EFLVEKSEFI HEASKLIAET LGSSSKI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010533837.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLV4KPG51e-100V4KPG5_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-67DNA-binding storekeeper protein-related transcriptional regulator