PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010533527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 644aa    MW: 72170.2 Da    PI: 4.7668
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010533527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.43.2e-54281541127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp GfrF+Ptdeel+++yL+ k++g++ ++ +vi+evd++k+ePwdLp  + +k+++ ew+fF++rd+ky++g+r+nrat+sgyWkatgkd++++
  XP_010533527.1  28 LPLGFRFRPTDEELINHYLCLKINGRHSDV-QVIPEVDVCKWEPWDLPslSVIKTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRTIK 121
                     699************************999.99***************6447888889************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyr 127
                     s k++l+g+kktLvfy+grapkge+t+W+mheyr
  XP_010533527.1 122 S-KKTLIGMKKTLVFYRGRAPKGERTNWIMHEYR 154
                     *.999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-6321178IPR003441NAC domain
PROSITE profilePS5100557.51428178IPR003441NAC domain
PfamPF023651.1E-2729154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MLKPLDSRQE KMKRDKEREM GAMSMESLPL GFRFRPTDEE LINHYLCLKI NGRHSDVQVI  60
PEVDVCKWEP WDLPSLSVIK TDDPEWFFFC PRDRKYPNGH RSNRATDSGY WKATGKDRTI  120
KSKKTLIGMK KTLVFYRGRA PKGERTNWIM HEYRPTQKEL DGSAPGQSPF VLCRLFHKPE  180
DRVNGVKSDE TERIGSTPST SKSLPDEASS DLVQETATSD FAIEKPLNDS KWFSGKCDEA  240
NADSMLTDGR YDYGHMNSED TEDYMAHETL VEAYALHGQN PSLSWLTCEP VDQTVPLHMD  300
SPYACDFGDD IVGSQFQNGT SELDVSLTEL LDEVFNNPDE SSCEESASQK NSVELSGISP  360
TRSVLPLQSV APDNAFLDDI GTFSDSDAEM VHLQYDTDFG ASGWYPERKE SLQMKNSFGS  420
VYDQVVQDDA FSGYPARPSH YNHFLHPEVM SNQMIPESNF SDGTGIKIRA RQPQNRPNAG  480
FVNQGTAPRR IRLQMQPNGV PPVETKPGEV KEGVETLDQN GVPEVQDKYS GGSVSKPTCM  540
LPCGSYREHY LQAGEDEIKQ SATDEYVGKP QIKIRSQRSR DRVKPDTVRE QEASDETAGQ  600
TWCGSEETEV VKRRERGVWA AVAAAVAAAA VVVGVMGWWM SLGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-49181787165NO APICAL MERISTEM PROTEIN
1ut4_B8e-49181787165NO APICAL MERISTEM PROTEIN
1ut7_A8e-49181787165NO APICAL MERISTEM PROTEIN
1ut7_B8e-49181787165NO APICAL MERISTEM PROTEIN
3swm_A8e-491817810168NAC domain-containing protein 19
3swm_B8e-491817810168NAC domain-containing protein 19
3swm_C8e-491817810168NAC domain-containing protein 19
3swm_D8e-491817810168NAC domain-containing protein 19
3swp_A8e-491817810168NAC domain-containing protein 19
3swp_B8e-491817810168NAC domain-containing protein 19
3swp_C8e-491817810168NAC domain-containing protein 19
3swp_D8e-491817810168NAC domain-containing protein 19
4dul_A8e-49181787165NAC domain-containing protein 19
4dul_B8e-49181787165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBMTransfer from AT4G35580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010533527.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010533527.10.0PREDICTED: protein NTM1-like 9
SwissprotF4JN350.0NTL9_ARATH; Protein NTM1-like 9
TrEMBLR0H2V40.0R0H2V4_9BRAS; Uncharacterized protein
STRINGXP_010533527.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.30.0NAC transcription factor-like 9
Publications ? help Back to Top
  1. Zheng XY, et al.
    Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73
    [PMID:26139525]
  2. Guo T, et al.
    Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana.
    Mol Plant, 2017. 10(10): p. 1334-1348
    [PMID:28943325]