PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010532574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CPP
Protein Properties Length: 691aa    MW: 76044.6 Da    PI: 5.4834
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010532574.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.9e-16387425240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_010532574.1 387 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 425
                     689**********************************96 PP

2TCR51.12.7e-16472510139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  XP_010532574.1 472 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 510
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19386427IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.564387512IPR005172CRC domain
PfamPF036387.6E-12389424IPR005172CRC domain
SMARTSM011143.7E-17472513IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11474510IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MDTPQKSTTQ IGTPVSKSKF EDSPVFNYIN SLSPIKPFKS IPIAQTFSSL SFVSPPSVFT  60
SPHIASHKES RFFRSNHRST DPSTPEAISR DGSASNEEAV SAPESFHTNS SMEEEEEEEA  120
SIEPSTDDFE MELPQIPKCE TTPNPKPSPC ARDGNEVRGG GGSLSTEVVG MDMQRMCLEQ  180
KKNDVPDWES LISDATELLI FSSPNDSEAF TGLLQRTSNS VERFCADVIP KMHDNPGNGE  240
DMEHEAIPNL HRGVRRRCLD FEVPRKQRNE LSHKQTISNT PGPESSSRCL LPSIGLHLNS  300
ITMSSKDRKA SVLHEYSFSG KIQVSLPLVH SQENARENFV RAENEMDEEA SQAVDDVSKA  360
SVSEELNLSS SPKKKRRKFD RSGEGESCKR CNCKKSKCLK LYCECFAAGV YCIEPCSCVD  420
CFNKPIHEDT VLATRKQIES RNPLAFAPKV IRNSDPVSEA GDDASKTPAS ARHKRGCNCK  480
KSNCLKKYCE CYQGGVGCSI NCRCEGCKNA FGRKDGSSMA GMEGEQEEEN ETTEKNGTAK  540
ALQNPEVFKE EEQNLSSGLP STPLPLYRQP LVQLPFPSKD WTTSQPFLGT GYSSSIFNGQ  600
SFGNSDIGFS QSRFDKNFET IVEDGTEDDG DDMPEILTRS PIATITVVSP NGKRVSPPHL  660
DSSGSILGRR NGGRKLILQS IPSFPSLTPH H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1739150914120Protein lin-54 homolog
5fd3_B5e-1739150914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1372376KKKRR
2372377KKKRRK
3373377KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010532574.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010532574.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_010532574.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]