PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010531074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 364aa    MW: 41725.7 Da    PI: 5.7327
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010531074.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.3e-5561341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  XP_010531074.1   6 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKTV 99 
                     69****************************.9***************953432233667************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ k++l+g++ktLvfy+grap+g+ktdW+mheyrl
  XP_010531074.1 100 YD-KTKLIGMRKTLVFYRGRAPNGQKTDWIMHEYRL 134
                     **.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-603155IPR003441NAC domain
PROSITE profilePS5100559.2796155IPR003441NAC domain
PfamPF023654.7E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MESCSVPPGF RFHPTDEELV GYYLRKKVAS QKIDLDVIRD IDLYRIEPWD LQERCRIGYE  60
EQNEWYFFSH KDKKYPTGTR TNRATMAGFW KATGRDKTVY DKTKLIGMRK TLVFYRGRAP  120
NGQKTDWIMH EYRLPPAENA PPQEEGWVVC RAFKKKANGQ AKNMETWGTS YFYGDVTSGG  180
MDPIHHICIS NRQQNLLGQS FMCKQELERS ADGPNFTIKN DQFIELPQLQ SPSPPLVKRP  240
ASSMSVTSDH SSYKSREDMD GSFNALINDK NKRKKEEEQV TADWRTLDKF VASQLMSQES  300
DGISGFGVQN RGNDIESNSD HIDKNEMGTM ATSLMESERD EENMFINGLL SSSSDCEIGI  360
CVFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-51116012170NO APICAL MERISTEM PROTEIN
1ut4_B7e-51116012170NO APICAL MERISTEM PROTEIN
1ut7_A7e-51116012170NO APICAL MERISTEM PROTEIN
1ut7_B7e-51116012170NO APICAL MERISTEM PROTEIN
3swm_A7e-51116015173NAC domain-containing protein 19
3swm_B7e-51116015173NAC domain-containing protein 19
3swm_C7e-51116015173NAC domain-containing protein 19
3swm_D7e-51116015173NAC domain-containing protein 19
3swp_A7e-51116015173NAC domain-containing protein 19
3swp_B7e-51116015173NAC domain-containing protein 19
3swp_C7e-51116015173NAC domain-containing protein 19
3swp_D7e-51116015173NAC domain-containing protein 19
4dul_A7e-51116012170NAC domain-containing protein 19
4dul_B7e-51116012170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010531074.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010531074.10.0PREDICTED: NAC domain-containing protein 37 isoform X2
RefseqXP_019057358.10.0PREDICTED: NAC domain-containing protein 37 isoform X2
SwissprotQ9SL410.0NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A1J3JI670.0A0A1J3JI67_NOCCA; NAC domain-containing protein 7
STRINGXP_010531074.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-174vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]