PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010530942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 318aa    MW: 36192.3 Da    PI: 8.5596
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010530942.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.21e-46411673128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yLk+ ++gk+  + +vi  ++iy+++PwdLp   k +e+ewyfF++rd+k+ +g r++r+t++gyWkatg+d++++s   
  XP_010530942.1  41 PGFRFHPTEEELLNFYLKNMIHGKRSCV-HVIGFLNIYHHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPSRTTAKGYWKATGSDRKIVSLse 134
                     9************************777.89***************8778899*************************************99765 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++gl+ktLvfy+grap g+ktdWvm+eyrl
  XP_010530942.1 135 PKRVIGLRKTLVFYRGRAPGGNKTDWVMNEYRL 167
                     6778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5631185IPR003441NAC domain
PROSITE profilePS5100553.24739185IPR003441NAC domain
PfamPF023651.2E-2541167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MRIQGVHQQT SSLNTINCWV YRVYKSDRNS EMATENELPL PGFRFHPTEE ELLNFYLKNM  60
IHGKRSCVHV IGFLNIYHHD PWDLPGLSKI GEREWYFFVP RDRKHGSGGR PSRTTAKGYW  120
KATGSDRKIV SLSEPKRVIG LRKTLVFYRG RAPGGNKTDW VMNEYRLPDS CPLPKDVVLC  180
KIYRKATSLK VLEQRAAMEE MEGKANQTHP TSPLSSSETI SSCGTQYDLI APIPMPQVVA  240
MEEENGISIH ESRTEKAEDE ERCRATEIKM PSSSLKLPSG SLPELQVPKS GTDWGQDQFL  300
SISPWLQNLT PIINLLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-44311856168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010530942.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010530942.10.0PREDICTED: NAC transcription factor 29-like
SwissprotQ10S653e-89NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLE4MXR01e-155E4MXR0_EUTHA; mRNA, clone: RTFL01-40-I17
TrEMBLV4M3M01e-155V4M3M0_EUTSA; Uncharacterized protein
STRINGXP_010530942.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-136NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]