PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010530139.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 580aa    MW: 64223.6 Da    PI: 4.5405
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010530139.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.1e-49171432128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     +pGfrFhPtdeelvv+yLk+k+ +++l++ +vi  vd+yk++P++Lp +  +k+++++w+fF++r++ky++g r++r +++gyWkatgkd++++ 
  XP_010530139.1  17 APGFRFHPTDEELVVYYLKRKICRRRLRV-NVIGVVDVYKWDPEELPgQsLLKSGDRQWFFFTPRSRKYPNGGRSSRGAANGYWKATGKDRTIVY 110
                     69***************************.99**************96347788999********************9999************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++vg+kktLvfy+grap+ge+tdWvmhey++
  XP_010530139.1 111 -NARAVGIKKTLVFYRGRAPNGERTDWVMHEYTM 143
                     .999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5616166IPR003441NAC domain
PROSITE profilePS5100553.60716166IPR003441NAC domain
PfamPF023656.7E-2618142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MADSSPDSCF KGGRFCAPGF RFHPTDEELV VYYLKRKICR RRLRVNVIGV VDVYKWDPEE  60
LPGQSLLKSG DRQWFFFTPR SRKYPNGGRS SRGAANGYWK ATGKDRTIVY NARAVGIKKT  120
LVFYRGRAPN GERTDWVMHE YTMDEEEFGK CQNAKDYYAL YKLYKKSGAG PKNGEQYGAP  180
FQEEEWVDDD KEDTNNAAEP MPLAVQAESA AHVDDGVLTH DDIEELLKGI ADAPEAPPRQ  240
INNLPYAFPQ INSEEEIQST LLNTSSGEIL IPKQTGEFMP NSQPNDKHLT FDSLMSAKSF  300
VATEVTSTTP KTMEAVPLMF EEENYLQMDD LLIPDLDASA VEKPLSPLNT DEFSGLNEFD  360
LLFHDVAMSF DMDPVSQGTT VSLSSINDFV NNAADPEQQY PYDQFQEQTV ESQLNNLTDP  420
SAVAPDQFTG DLWLQEEMAH LVDGSQYYSE GRASPSSGVI HGPTNPPMAP ATQDPGGKNG  480
PGATSQFSNS LWTLVESIPS PPASACEGPL NRTFVRMSSF SRIRFTSKAN GTSVASNNTA  540
IAKKPSSNRG FLLLSILGAL CAIFWVFIAT VRVSERSVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-471814317140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010530139.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010530139.10.0PREDICTED: NAC domain-containing protein 17-like
SwissprotQ9XIC50.0NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A178WNW40.0A0A178WNW4_ARATH; NAC017
STRINGXP_010530139.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.10.0NAC domain containing protein 17
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Van Aken O, et al.
    Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases.
    Plant Physiol., 2016. 171(3): p. 2150-65
    [PMID:27208304]
  3. Van Aken O,Ford E,Lister R,Huang S,Millar AH
    Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance.
    Plant J., 2016. 88(4): p. 542-558
    [PMID:27425258]
  4. Hu Z, et al.
    Mitochondrial Defects Confer Tolerance against Cellulose Deficiency.
    Plant Cell, 2016. 28(9): p. 2276-2290
    [PMID:27543091]
  5. Chi YH, et al.
    The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647
    [PMID:28088515]
  6. Van Aken O,Pogson BJ
    Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death.
    Cell Death Differ., 2017. 24(6): p. 955-960
    [PMID:28498364]
  7. Cheng P, et al.
    The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 182
    [PMID:29497438]