PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010530009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 271aa    MW: 30858.7 Da    PI: 10.6771
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010530009.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-32178231255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+av+ LGG+e+AtPk++lelm+v++Ltl+hvkSHLQ+YR+
  XP_010530009.1 178 PRMRWTTTLHARFVHAVQLLGGHERATPKSVLELMDVQDLTLAHVKSHLQMYRT 231
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-15175232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28176232IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24178232IPR006447Myb domain, plants
PfamPF002491.4E-7179230IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MELFPSEPDL YLQIGPPNSK TSLECGRREE QVEMRLGFWS KPSHSDRTSS SLVSRALNTA  60
HRHPHHFTTI NQSTNCFLHP FHQQPQENKT LYDQDQDLRS ILMRPIRGVP IHQNHLYIQS  120
FLPSASPTPF FRGKNRNVAS NFNPGFHHGH RYQATVNRAS SSPRFTSKFM ERRGVRAPRM  180
RWTTTLHARF VHAVQLLGGH ERATPKSVLE LMDVQDLTLA HVKSHLQMYR TIKSAEKGSD  240
DACGNGSSGG NCEGQKQKGR NLQGLWNNSS R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010530008.10.0PREDICTED: probable transcription factor KAN3 isoform X1
RefseqXP_010530009.10.0PREDICTED: probable transcription factor KAN3 isoform X2
SwissprotQ941I22e-71KAN3_ARATH; Probable transcription factor KAN3
TrEMBLD7M9G74e-74D7M9G7_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.7__2541__AT4G17695.11e-73(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.16e-71G2-like family protein