PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529836.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 232aa    MW: 26235.7 Da    PI: 9.4158
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529836.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-322073255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtpeLH++Fv a+e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  XP_010529836.1 20 PRLRWTPELHHCFVLAIERLGGQHKATPKLVLQLMDVKGLTISHVKSHLQMYRS 73
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-311676IPR009057Homeodomain-like
PROSITE profilePS5129411.8511676IPR017930Myb domain
SuperFamilySSF466891.67E-151875IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-242074IPR006447Myb domain, plants
PfamPF002493.7E-82172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MVSCGRSNGA VRQYVRSKVP RLRWTPELHH CFVLAIERLG GQHKATPKLV LQLMDVKGLT  60
ISHVKSHLQM YRSMKSDLGC RQDQRRQFTE EYDGCVVDHS SLYSIGLHSS IRKRARGAER  120
KRMWSVEEEH QRKNQNQNQN QSYGKENIDA PPPFNLLKMP EKEEEEAAIG EGLSLSLRGP  180
YTHGSNCYST SETSAVSSAS TSLFKRGSPP PESPCHRHRY INLDLSIALS GC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529836.11e-175PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLD7SMG89e-53D7SMG8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0137g00050.t013e-52(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.13e-33G2-like family protein