PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529684.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 637aa    MW: 70861.6 Da    PI: 6.7224
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529684.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.3e-54111381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp GfrF+Ptdeel+++yL+ k++g++ e+ +vi+evd++k+ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat++gyWkatgkd++++
  XP_010529684.1  11 LPLGFRFRPTDEELINHYLRLKINGRDSEV-RVIPEVDVCKWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDTGYWKATGKDRTIK 104
                     699************************999.99***************6448899999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s k+ +vg+kktLvfy+grap+ge+t+W+mheyr+
  XP_010529684.1 105 S-KKMAVGMKKTLVFYRGRAPRGERTNWIMHEYRA 138
                     *.9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-646161IPR003441NAC domain
PROSITE profilePS5100558.88211161IPR003441NAC domain
PfamPF023657.7E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MATATLSVEA LPLGFRFRPT DEELINHYLR LKINGRDSEV RVIPEVDVCK WEPWDLPGLS  60
VIKTDDQEWF FFCPRDRKYP SGHRSNRATD TGYWKATGKD RTIKSKKMAV GMKKTLVFYR  120
GRAPRGERTN WIMHEYRATD KDLDGNGPGQ NPYVLCRLFH KPSDSCGTAN CDELENAKST  180
PTSTKSIPDD TSSEMVQETA TSRSQASKET DDTEKSPSGK YDDVKPNDPL IDKSFANRVT  240
ASHTGDTVLG KNMVEENDPF ARDIPNLYGP SFAQIGNKTI CPAQSSIGFA ASHMDSLYDS  300
DFGNSDSMLH FQDGASLQDV SLTAVLDEVF GNYNEPSCEE STKGKDIALP RMMHFPGGNT  360
SMLSAMNPFL SDTVPFVDSD AVVAGAQQYV PDIVGSKWVG EPVDYKEFVE RQTLSGTSRT  420
LTPMHGHASY ATIDPFHLNP DVLEGSFVGP GDVTRLGARD GQHQPNSDFF VDQGTAPRRL  480
RLQVERSPSS VDSKGDRAAG HSEEDEVQSA ISEVEYDKGQ SQSACSGIQS ASRRRILLRM  540
RRQKPPSETG LEGKDEDPLG RHLKLRPKHG KFTMAQLKRR LQFSSSSRSS SVMMVVTMVM  600
VLAMAIFVGM WRRGWFGIIT KNAKNNLLFH SLRDMMM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-4731659169NO APICAL MERISTEM PROTEIN
1ut4_B5e-4731659169NO APICAL MERISTEM PROTEIN
1ut7_A5e-4731659169NO APICAL MERISTEM PROTEIN
1ut7_B5e-4731659169NO APICAL MERISTEM PROTEIN
4dul_A5e-4731659169NAC domain-containing protein 19
4dul_B5e-4731659169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010529684.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529684.10.0PREDICTED: NAC domain-containing protein 14
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLD7KIF50.0D7KIF5_ARALL; ANAC014
STRINGXP_010529684.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.10.0NAC 014