PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 261aa    MW: 29163.6 Da    PI: 8.4359
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.2e-322478155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLH+rFv+av++LGG++kAtPk++l+lm++kgLtl h+kSHLQkYRl
  XP_010529238.1 24 KPRLRWTAELHDRFVDAVTKLGGADKATPKSVLKLMGLKGLTLFHLKSHLQKYRL 78
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1632181IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-312182IPR009057Homeodomain-like
SuperFamilySSF466898.42E-172481IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-242479IPR006447Myb domain, plants
PfamPF002496.4E-92677IPR001005SANT/Myb domain
PfamPF143796.8E-14128170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEMMKLGGSI GYENGGVVMT RDPKPRLRWT AELHDRFVDA VTKLGGADKA TPKSVLKLMG  60
LKGLTLFHLK SHLQKYRLGQ QQAKKLNHAD DNKENAGSSY VHFNTHSQGD FSNLPRIDNQ  120
QRNIPFGESS RHQVEGQQKL RQQLEVQKKL QMRIEAQGKY LLALLDKAKT SFPTLANLPS  180
DAEATTGQFS DFNLTLEGSN DGEEKSQKVA SSTADTSNNS ESEDFGVCRE RENENSKSGY  240
DLMTLGNYGM EIKPNVFADR H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529238.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK52e-44APL_ARATH; Myb family transcription factor APL
TrEMBLA0A087GNV01e-113A0A087GNV0_ARAAL; Uncharacterized protein
STRINGBra025071.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124952530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-105G2-like family protein