PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529123.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 288aa    MW: 33281.9 Da    PI: 5.9215
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529123.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.3e-5461331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+kveg ++el evi+e+d+yk++Pw+Lp k  + +++ ew+fF++rdkky++g+r+nratk+gyWkatgkd++++
  XP_010529123.1   6 LPPGFRFHPTDEELVGYYLKRKVEGLEIEL-EVIPEIDLYKFDPWELPdKsFLPNRDMEWFFFCPRDKKYPNGSRTNRATKAGYWKATGKDRKIT 99 
                     79****************************.99**************96435556888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++ g +ktLvfy+grap g +t+Wvmheyrl
  XP_010529123.1 100 C-HSSVSGYRKTLVFYEGRAPLGDRTHWVMHEYRL 133
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-593158IPR003441NAC domain
PROSITE profilePS5100558.3426158IPR003441NAC domain
PfamPF023658.1E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MASSSLPPGF RFHPTDEELV GYYLKRKVEG LEIELEVIPE IDLYKFDPWE LPDKSFLPNR  60
DMEWFFFCPR DKKYPNGSRT NRATKAGYWK ATGKDRKITC HSSVSGYRKT LVFYEGRAPL  120
GDRTHWVMHE YRLSDDDLSR GSKNSKGCAF ALCRVVRKNE QKGTNYLEKN PRDKKFPNEQ  180
MVDQTPSFTS CNPNFTTADS CNIWISPDFI LDSSKDYPQI QEVASEYFPK HDFSCANNEW  240
EGVDFSASPW CSNVDHNIDQ SVQTCYWTNI GYGDGHYSGY NNQTGSFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-54115912166NO APICAL MERISTEM PROTEIN
1ut4_B9e-54115912166NO APICAL MERISTEM PROTEIN
1ut7_A9e-54115912166NO APICAL MERISTEM PROTEIN
1ut7_B9e-54115912166NO APICAL MERISTEM PROTEIN
3swm_A8e-54115915169NAC domain-containing protein 19
3swm_B8e-54115915169NAC domain-containing protein 19
3swm_C8e-54115915169NAC domain-containing protein 19
3swm_D8e-54115915169NAC domain-containing protein 19
3swp_A8e-54115915169NAC domain-containing protein 19
3swp_B8e-54115915169NAC domain-containing protein 19
3swp_C8e-54115915169NAC domain-containing protein 19
3swp_D8e-54115915169NAC domain-containing protein 19
4dul_A9e-54115912166NAC domain-containing protein 19
4dul_B9e-54115912166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in the positive regulation of abscisic acid (ABA) responsive genes. Acts as a positive factor of ABA-mediated responses. Involved in the transcriptional activation of ABA-inducible genes in response to dehydration and osmotic stresses. Plays a positive role in both stomatal closure and water loss under dehydration stress conditions. Acts synergistically with ABF2 to activate the dehydration stress-response factor RD29A transcription. Binds to the consensus core cis-acting elements 5'-CGTA-3' and 5'-CACG-3' at the RD29A promoter (PubMed:24285786). Involved in hypocotyl graft union formation. Required for the auxin-mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:25182467). {ECO:0000269|PubMed:24285786, ECO:0000269|PubMed:25182467}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010529123.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and osmotic stress. {ECO:0000269|PubMed:24285786}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529123.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9LS241e-122NAC96_ARATH; NAC domain-containing protein 96
TrEMBLA0A087GF311e-129A0A087GF31_ARAAL; Uncharacterized protein
STRINGXP_010529123.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.11e-124NAC domain containing protein 96
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]