PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010529031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 360aa    MW: 40881.2 Da    PI: 6.6868
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010529031.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-3267120255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH rFv+av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  XP_010529031.1  67 PRLRWTPDLHLRFVHAVDRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 120
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.59363123IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2963121IPR009057Homeodomain-like
SuperFamilySSF466898.42E-1565122IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2267122IPR006447Myb domain, plants
PfamPF002495.2E-968119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEGGGDAEYS KTSRYERIEI NESGEEEEEE EEEEEGGGGE SKASSNSTVE ESDKKPKVRP  60
YVRSKVPRLR WTPDLHLRFV HAVDRLGGQE RATPKLVLQL MNIKGLSIAH VKSHLQMYRS  120
KKTDDQCQAM AEHRHLIEST TDRNIYNLSQ LPMFRAYSHD HDSPFRYGNA SMWNSSSHVP  180
DRSLIDQLRP GFVRGSVVNN WANNMMNRSF QNISSSLVSS HLGMLRQNRT QILDQDSPGT  240
FKNIQDQRSG TINKLELHHD IAQETDNNAY YNKMGKRKAS ERIDLDLDLS LKLARHEKAS  300
LDETERDQTL SLSLGSGSSS WKQSRTLKKT DEEDDNGTAK RLLSSHEHGI GRASTLDLTL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010529031.10.0PREDICTED: uncharacterized protein LOC104806008
TrEMBLQ8GYE41e-117Q8GYE4_ARATH; Myb-like HTH transcriptional regulator-like protein
STRINGAT2G38300.11e-117(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-113G2-like family protein