PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528789.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family GeBP
Protein Properties Length: 381aa    MW: 41989.3 Da    PI: 5.8173
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528789.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57396.62.5e-30120211597
          DUF573   5 rlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     r+++eeD++++L ++i+++ ktg++ps+d  afy+fvk+s++++vsk+q+++Kir+L+kKf+++v k ++++e +f+  hd+k+f+ls++iWg
  XP_010528789.1 120 RIFTEEDDVLMLEAIIEYRVKTGTEPSSDPGAFYDFVKGSLHVEVSKTQVMDKIRSLQKKFRGMVGKYRHEQELAFT-RHDSKVFDLSMQIWG 211
                     9******************************************************************9999999997.599***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.9E-26120211IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MPKSTPLSDN SPPISANDGN DAGDCLPVRS TVVSGKESAG SSKLRSKRSA SDMIDGAKGK  60
DEAETVRIKK KKKKKTKGLS SSSEAATGAA QEDVVFSPVA GSAGTTVADV EEGKKIPGGR  120
IFTEEDDVLM LEAIIEYRVK TGTEPSSDPG AFYDFVKGSL HVEVSKTQVM DKIRSLQKKF  180
RGMVGKYRHE QELAFTRHDS KVFDLSMQIW GVTDSIGEKP IGSDAPQMKH TVGTIDTTGK  240
KPVTRRLQKQ NAVEKHQEPG NAEDEDNYEE NDRDVQVVGN GMDVAAEDRV EGKEGRHDDA  300
DDFWARFPFL KDGVETMLSE GVFLDFPRKL LLEKVVCFGG DKGKEWDAKW KDLRVEEMGL  360
RIRKLDLMAR FSQAALDELK K
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16874KKKKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528789.10.0PREDICTED: uncharacterized protein LOC104805808
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14280.12e-25DNA-binding storekeeper protein-related