PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528768.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 397aa    MW: 43431.1 Da    PI: 8.565
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528768.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.5e-344296155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wtp+LHerFveav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  XP_010528768.1 42 KPRLKWTPDLHERFVEAVHQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 96
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1723999IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-324097IPR009057Homeodomain-like
SuperFamilySSF466897.88E-174197IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-234297IPR006447Myb domain, plants
PfamPF002492.1E-104495IPR001005SANT/Myb domain
PfamPF143791.0E-22144188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MYQGKNMNSS SRMPVTAPER HLFLHPGNGP GDPGLVLSTD AKPRLKWTPD LHERFVEAVH  60
QLGGADKATP KTVMKLMGIP GLTLYHLKSH LQKYRLSKNI HGQANNGVHR ISVVAMSGDK  120
RPESAGTNMA NLNIGTQMNK NSPIGEAIQM QIEVQRRLHE QLEVQRHLQM QMEAQGKYLQ  180
AVLEKAQEML GRQNLGSVGL EAAKIQLSEL VSKVSNECLR SRLSGMKELH GFCPQQRIRQ  240
AARPADCSLE SCLTTCEASQ MEEQLGLSTY SGSSLIFKSK DIVEEPLLRQ TELNWSGELK  300
ENRRLTGKES GRRTFSGGRS SVNDLSIGVG PTNDADYAYG ATENEASGSA GRVSGERGSN  360
EYNLSYFATK LDLNTGGETD SAMKGCKQLD LNGFGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528768.10.0PREDICTED: uncharacterized protein LOC104805787
TrEMBLA0A061F2V11e-167A0A061F2V1_THECC; Homeodomain-like superfamily protein isoform 1
TrEMBLA0A061F9P81e-167A0A061F9P8_THECC; Homeodomain-like superfamily protein isoform 2
STRINGPOPTR_0013s05670.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-138G2-like family protein