PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 626aa    MW: 70941.1 Da    PI: 5.4335
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528598.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.6e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v 
  XP_010528598.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVS 99 
                     79****************************.99***************6434555777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++ vg+kktLv+y grap+g++tdWvmheyrl
  XP_010528598.1 100 S-QSRSVGTKKTLVYYGGRAPHGSRTDWVMHEYRL 133
                     9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-644156IPR003441NAC domain
PROSITE profilePS5100561.3856156IPR003441NAC domain
PfamPF023659.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MAPVALPPGF RFHPTDEELV AYYLKRKING RKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVSS QSRSVGTKKT LVYYGGRAPH  120
GSRTDWVMHE YRLDEHECES KSGLQDAYAL CRVFKKNAVS PKVEEQCVDG MKSSITNAMN  180
MNSEQSSSTG MYSEGKYEDL ESSGYPISPD VYGTQFRNIP SSDIETREEK WSQFLSQDSF  240
NLPAPSQFCS QYGPTNSYPP FKVDIAFECE RLQNRLSLPP LHMEDLPHAG FLETDLLNNT  300
DDVLNKILSI AQASQEQASN QVSWNAACGS QNIHGDNFDF AGERFANFNN RNGENSWEEA  360
NLNAVGAQGP AERFKEERMI ENLRWVGVSS KELEKSFIEE HTRIVPVESI WSYRRDDQEH  420
ESQDGAGFKN SDGDLDDVVT LEFSDDEHNG NLAEQENGNI TDVEVVKRVK FSRGMFVTTR  480
QVTNTFFQQI VPSQTVIVYI NPATTVGEKQ APDEAGDHAI PKIEPFEERK FSGSIFEPWR  540
KVAHVIGFIP MLLLMHCVQR GSNSNNIERI QGRKEHHRIH DNDNQDQSLV GNGSRVHHQE  600
SFVLVVLKKL GVSLAIVFAL STLCLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B1e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A1e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_B1e-56116212171NO APICAL MERISTEM PROTEIN
3swm_A1e-56116215174NAC domain-containing protein 19
3swm_B1e-56116215174NAC domain-containing protein 19
3swm_C1e-56116215174NAC domain-containing protein 19
3swm_D1e-56116215174NAC domain-containing protein 19
3swp_A1e-56116215174NAC domain-containing protein 19
3swp_B1e-56116215174NAC domain-containing protein 19
3swp_C1e-56116215174NAC domain-containing protein 19
3swp_D1e-56116215174NAC domain-containing protein 19
4dul_A1e-56116212171NAC domain-containing protein 19
4dul_B1e-56116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010528598.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528598.10.0PREDICTED: NAC domain-containing protein 86 isoform X1
TrEMBLV4KFM30.0V4KFM3_EUTSA; Uncharacterized protein
STRINGXP_010528598.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101122632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.10.0NAC domain containing protein 28