PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 310aa    MW: 34638 Da    PI: 6.4067
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528355.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-55231491129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv ++ +++ ++i e+d++kvePwdLp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010528355.1  23 LPPGFRFHPTDEELITQYLRPKVLNTFFSA-TAIGEADLNKVEPWDLPWRAKMGEKEWYFFCLRDRKYPTGLRTNRATEAGYWKATGKDKEIFK- 115
                     79*************************999.88***************888999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfykgrapkgekt+W+mheyrle
  XP_010528355.1 116 GKSLVGMKKTLVFYKGRAPKGEKTNWIMHEYRLE 149
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5821153IPR003441NAC domain
PROSITE profilePS5100554.09323163IPR003441NAC domain
PfamPF023651.3E-2924148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDFTPRTGEI VGGGESEEEH IDLPPGFRFH PTDEELITQY LRPKVLNTFF SATAIGEADL  60
NKVEPWDLPW RAKMGEKEWY FFCLRDRKYP TGLRTNRATE AGYWKATGKD KEIFKGKSLV  120
GMKKTLVFYK GRAPKGEKTN WIMHEYRLEG RYSIGNLSKT TKKRADGKKV HISGLMGFSS  180
SANPFGSTGL PHVTCFADQA TEDDDERPSC ESNDGFTPPL SGPTSAFQRV SSFSSLPQLI  240
PNYGSQLYAD SVLLQDSPIL KMLLHGQVTD NNQIPEFLDP SATELVPRPL ESIVHPGSPG  300
SAEPGCYWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-492014814142NO APICAL MERISTEM PROTEIN
1ut4_B4e-492014814142NO APICAL MERISTEM PROTEIN
1ut7_A4e-492014814142NO APICAL MERISTEM PROTEIN
1ut7_B4e-492014814142NO APICAL MERISTEM PROTEIN
4dul_A4e-492014814142NAC domain-containing protein 19
4dul_B4e-492014814142NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010528355.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528355.10.0PREDICTED: NAC domain-containing protein 92-like isoform X3
SwissprotQ9LJW31e-109NAC59_ARATH; NAC domain-containing protein 59
TrEMBLA0A1J3G1X41e-115A0A1J3G1X4_NOCCA; Uncharacterized protein
STRINGXP_010528353.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.11e-109NAC domain containing protein 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]