PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 349aa    MW: 38357.3 Da    PI: 6.1913
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.8e-31193248156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W++ LH+rF++a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  XP_010528047.1 193 KQRRCWSQYLHRRFLNALQQLGGAHVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 248
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.919190250IPR017930Myb domain
SuperFamilySSF466891.08E-15191251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-27191251IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-27193248IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0016036Biological Processcellular response to phosphate starvation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0080022Biological Processprimary root development
GO:1901699Biological Processcellular response to nitrogen compound
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MIKSINNMEY SQKLQRCGEY IEALQEERSK ILVFQRELPL CLDLVTQAIE ACKREISGTT  60
TENVNGQSEC SEQTTGECGG PVLEEFIPIR PPSSSHDDGG DDDDDGDEHE SHHSNEKSDD  120
NNTKSDWLKS AQLWNQPVPT PAEERPQEKE AVDEVKSNGD ENRKIPATEG SGGCGGGGCQ  180
KNEPEKESGG KRKQRRCWSQ YLHRRFLNAL QQLGGAHVAT PKQIREVMKV DGLTNDEVKS  240
HLQKYRLHTR RPSQTVPNKG SQQAPHFVVV GGMWVPQTDY ASAKSAVATS ATAGIYGAAM  300
PPQWPSHSNN FGPLISQDRS TCGREGEARC GSPVMSSSTR PNVKDGKKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00140DAPTransfer from AT1G13300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528047.10.0PREDICTED: probable transcription factor GLK2
TrEMBLV4L6X81e-131V4L6X8_EUTSA; Uncharacterized protein
STRINGscaffold_101490.11e-130(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.11e-123G2-like family protein