PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010527844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 282aa    MW: 31898 Da    PI: 6.2356
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010527844.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.6e-332578255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtpeLH++Fv+av++LGG++kAtPk +l++m+vkgLt++hvkSHLQ+YR 
  XP_010527844.1 25 PRLRWTPELHRCFVNAVDSLGGQHKATPKLVLRMMDVKGLTISHVKSHLQMYRG 78
                    8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-302178IPR009057Homeodomain-like
PROSITE profilePS5129412.8472181IPR017930Myb domain
SuperFamilySSF466896.81E-152477IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-242578IPR006447Myb domain, plants
PfamPF002492.8E-82677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRCGRSNVD GNGNGVRQYV RSPAPRLRWT PELHRCFVNA VDSLGGQHKA TPKLVLRMMD  60
VKGLTISHVK SHLQMYRGSK LALGKQVENS SPRRRQDDSG EEHDNWSVHT RNDCHFGSQP  120
YLSRHSSPSR GRADQRMMSV SACEDEEEVD DDDDDDAELH LNLKMDNRGT MPHSFIFQSR  180
FLKVQNPEDE KINWENTWRE HEERKEGEEE EGEFSECELS LSLSLNHRRP SSRRSNGSSS  240
ISESSEAFSS CSAPFVFKDC SASSSAQQQN LNLNLSISLL GS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010527844.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
SwissprotQ700D91e-60MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A078F8F82e-79A0A078F8F8_BRANA; BnaA02g26180D protein
TrEMBLM4ECV82e-79M4ECV8_BRARP; Uncharacterized protein
STRINGBra026618.1-P5e-79(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-48G2-like family protein