PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010527686.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 495aa    MW: 54749.6 Da    PI: 6.7678
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010527686.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.23.5e-08190252163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     eke +r rr   NRe+Ar   +R++a +eeL +k+  L+ eN +Lk e +   ke ++l++ +
  XP_010527686.1 190 EKEERRIRRILANRESARQTIRRRQALCEELNRKASDLSYENAQLKREKDWALKEFQSLEMIN 252
                     78999*******************************************999999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001705.0E-7190252IPR004827Basic-leucine zipper domain
SMARTSM003381.6E-9190254IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703192255IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-6194260No hitNo description
SuperFamilySSF579597.69E-6194249No hitNo description
CDDcd147023.19E-13195246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MELEQVSSCC SSSSPSPSSS AASDSSPLGE GAADRTELEA AEALADLAQL ALVREKVVES  60
AAKWGRKGKR VRKRVKNESP PCNPVLKPAD SEPPASDPAE FAECIEPLVI SNALGNINEK  120
LGSLESVTLF LYQERAVKEE QEAQAIGRDL TIVPVKTEVD EETPKQLLAS TLKCRSSGGG  180
RWRQNLSEAE KEERRIRRIL ANRESARQTI RRRQALCEEL NRKASDLSYE NAQLKREKDW  240
ALKEFQSLEM INKHLKEQLS RSIKPEAKEH DEAPKASQVE TAASAPFCCY NQHPFQLFCW  300
SPVIQSSSSA ALPQNGLTVP SMISARASTK VEPSKEQEKP GNDDGMKPPF YIVPCPWFLP  360
PPGQTNGVQT VVPYELENIQ EGCSLRHVDN IQSLPSRLPS ITKEGDSTRG FYDLNKSAPD  420
IPAEGEPSFF FKHEEASQPA NGPALISLPE ESRGYVGYSS SKRLVDSVAA ADARKRRKEL  480
TRLKNLHSRQ CRMQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1473478RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010527686.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010527686.10.0PREDICTED: uncharacterized protein LOC104804992 isoform X1
TrEMBLV4L5161e-129V4L516_EUTSA; Uncharacterized protein (Fragment)
STRINGXP_010527686.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-111bZIP family protein