PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010527494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 155aa    MW: 17101.4 Da    PI: 8.7479
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010527494.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like55.41.4e-173073851
         G2-like  8 peLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                    + LH rFv+ v+q+GG++k tPkt++ +m +k+Lt+ + kSH Q
  XP_010527494.1 30 SLLHGRFVDTVTQIGGPDKSTPKTVMGTMRLKCLTICQFKSHFQ 73
                    569****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-133073IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-113074IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDSAIQSLPF DTSVGGQRRV PWSSLWDRSS LLHGRFVDTV TQIGGPDKST PKTVMGTMRL  60
KCLTICQFKS HFQSALSQDT GSSSTPFIEN GVMAAPNERI EAKGKYLKAI LEKALDEKTT  120
SFFWARGLKE KSSQSGVKEQ TVMFETTQDG DAIFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010527494.11e-112PREDICTED: myb family transcription factor APL-like
TrEMBLA0A087H2A22e-18A0A087H2A2_ARAAL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-21G2-like family protein