PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 321aa    MW: 34942.9 Da    PI: 4.9492
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526995.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085.2e-3447101155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  XP_010526995.1  47 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 101
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.33744104IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3246102IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1846101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2647102IPR006447Myb domain, plants
PfamPF002491.4E-949100IPR001005SANT/Myb domain
PfamPF143792.2E-22134179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MFQTSNVLNA NLACSSSPIP GDRLDLSPME PINGGNNANN NPSLASKQRL RWTNELHERF  60
VDAVAQLGGP DRATPKGVLR VMGVQGLTIY HVKSHLQKYR LAKYLPDSSS EGKQMDKKES  120
GDMLAVLDGS SGTQITEALK LQMEVQKRLH EQLEVQRQLQ QRIEAQGKYL KKIIEEQQRL  180
SGVIGEPSDP REGDNSPEGD NGNDPGTPAA ISESPIQDKS GKEGGKEKSL SVDNESLSSY  240
PEPLTPDSGF NNDYPRDRSG GEERSSKKPR LARGGVEPLI LESGLDPLFI LKGQCDNPSG  300
TMVGGSEARL EDLDKVSVEN L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526987.10.0PREDICTED: uncharacterized protein LOC104804400
RefseqXP_010526995.10.0PREDICTED: uncharacterized protein LOC104804400
TrEMBLB9SGW91e-130B9SGW9_RICCO; Transcription factor, putative
TrEMBLD7LQZ51e-131D7LQZ5_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.5__3__AT2G01060.11e-130(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-109G2-like family protein