PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 279aa    MW: 31521 Da    PI: 8.3047
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526869.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.5e-4781343128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yL++ ++gk+  + evi  ++iy+++PwdLp   k +e+ewyfF++rd+k+ tg r++r+t++gyWkatg+d++++s   
  XP_010526869.1   8 PGFRFHPTEEELLSFYLRNMIHGKRSCI-EVIGFLNIYHYDPWDLPGLSKIGEREWYFFVPRDRKHGTGGRPSRTTAKGYWKATGSDRKIVSLse 101
                     9************************888.99***************8778899*************************************99765 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++gl+ktLvfy+grap g+ktdWvm+eyrl
  XP_010526869.1 102 PKRVIGLRKTLVFYRGRAPGGNKTDWVMNEYRL 134
                     6778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-565152IPR003441NAC domain
PROSITE profilePS5100553.9856152IPR003441NAC domain
PfamPF023651.8E-258134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MAKENELPGF RFHPTEEELL SFYLRNMIHG KRSCIEVIGF LNIYHYDPWD LPGLSKIGER  60
EWYFFVPRDR KHGTGGRPSR TTAKGYWKAT GSDRKIVSLS EPKRVIGLRK TLVFYRGRAP  120
GGNKTDWVMN EYRLPDSCPL PKDVVLCKIY RKATSRKVLE QRAAMDEMEG KASQTYPTSP  180
LSSSETMASC GTQNDLIAHI PTPQLPQVVA MEENNEISIQ ESHVENEEGK GPSSSLKLPF  240
GSLPELQVPK SGTDWGQDPL LSISPWLQNL TPIVNLLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-44815522171NAC domain-containing protein 19
3swm_B2e-44815522171NAC domain-containing protein 19
3swm_C2e-44815522171NAC domain-containing protein 19
3swm_D2e-44815522171NAC domain-containing protein 19
3swp_A2e-44815522171NAC domain-containing protein 19
3swp_B2e-44815522171NAC domain-containing protein 19
3swp_C2e-44815522171NAC domain-containing protein 19
3swp_D2e-44815522171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010526869.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526869.10.0PREDICTED: NAC domain-containing protein 35
SwissprotQ10S656e-88NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLD7L8Q91e-148D7L8Q9_ARALL; ANAC036
STRINGXP_010526869.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-150NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]