PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 354aa    MW: 39633.2 Da    PI: 5.2484
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526733.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-31210264256
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     +r+rW+peLH++F++a+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYR++
  XP_010526733.1 210 QRRRWSPELHRKFIDALQRLGGSKVATPKQIRELMQVQGLTNDEVKSHLQKYRIH 264
                     8****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-28206267IPR009057Homeodomain-like
PROSITE profilePS5129413.285206266IPR017930Myb domain
SuperFamilySSF466891.02E-17207267IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-25210264IPR006447Myb domain, plants
PfamPF002491.5E-8211262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVETDTVRRM ELNLDLGVYC LPKPLSEFLH EVSQINDCPS ALSEIHGFVD RLEEERRKID  60
VFKRELPLCM LLLNEAIGRL KEEATRCAEA GDGSAVEGSN RKFDDGGGAK VENDKKNWMS  120
SAQLWISNSD SQMQSRNEEE EEDRSAPPNP SPSCNFANKG GEFPPFSRLY GSCHPPPLTL  180
MPPASVMVVN CRVDRHQPSK PSNQNQKKEQ RRRWSPELHR KFIDALQRLG GSKVATPKQI  240
RELMQVQGLT NDEVKSHLQK YRIHVRKHPI SRADETVETA GGLHQIPCKD KDSESQSDSP  300
QGPLIRRGFS GDGGGLSSEA AEGEDDNEDD EEAVSDGQSR KNATNMKEEM DLKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526733.10.0PREDICTED: uncharacterized protein LOC104804217
TrEMBLR0GZX21e-115R0GZX2_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G37180.21e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-117G2-like family protein