PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 442aa    MW: 49208.2 Da    PI: 5.6281
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526487.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085e-34237291155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+ mkv+gLt++hvkSHLQkYR+
  XP_010526487.1 237 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKRMKVEGLTIYHVKSHLQKYRT 291
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.373234294IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-31234293IPR009057Homeodomain-like
SuperFamilySSF466891.36E-17235291IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-24237291IPR006447Myb domain, plants
PfamPF002492.0E-10239290IPR001005SANT/Myb domain
PfamPF143791.5E-24323367IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MEARPIHRSG SRLLDNLARA SSMPSVPVTS PSEEIYSKSE NIQRVSLLER EIMSRPLGET  60
YQLLSANGGA VGHIFSSSSG LSSDLHHSSI QHAGNSNAPF ISQTSSNNGS WCPDSLPGFL  120
DFPANSPIHN GPMEGSSIMV SDDINKRGDW QEWADHLITD DDALMSTNWN DLLIDTSSNS  180
DSKGQNLCTQ TPIQQPSQVV QQHPSPSLEL RPVVNATSLN NNNNNSNNNS NNASSAKPRM  240
RWTPELHEAF VEAVNQLGGS ERATPKGVLK RMKVEGLTIY HVKSHLQKYR TARYRPEPSE  300
GSSEKKLTPL EQISSLDLKT GIDITEALRL QMEVQKQLHE QLEIQRNLQL RIEEQGKYLQ  360
MMFEKQNPGT DKLKGSSSSN PENVIPDSPT KPEEENKKTA DTEKTRKNAS EKQEEDGTEE  420
TRKSDDDPES HSPQPKRQRK DE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526487.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_010526488.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_010526489.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN54e-82PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLE4MWS31e-166E4MWS3_EUTHA; mRNA, clone: RTFL01-12-I21
TrEMBLV4P4I01e-166V4P4I0_EUTSA; Uncharacterized protein
STRINGAT4G28610.11e-156(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-143phosphate starvation response 1