PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526465.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CPP
Protein Properties Length: 605aa    MW: 63977.5 Da    PI: 8.2822
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526465.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.21.9e-14129169142
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  XP_010526465.1 129 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCANCFNNVEN 169
                     589**************************.********9875 PP

2TCR50.93e-16214253140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  XP_010526465.1 214 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNYE 253
                     589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-15129169IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.676130254IPR005172CRC domain
PfamPF036381.4E-10131166IPR005172CRC domain
SMARTSM011141.1E-19214255IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-12217252IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MGEGGDGSEF PPKKEQPEAS DFPAKKPARQ LDFTGGADAV LTEHSQSKAP APAPATAAAM  60
KTSTAPAASS TAARPAAAGI GQVRSTMPAV APMPPSVTQV LHTPVRLSKP ESPKSRARPA  120
VDARDGTPQK KKQCNCKHSR CLKLYCECFA SGTYCDGCNC ANCFNNVENE AARREAVEAT  180
LERNPTAFRP KIASSPHSAR DSGEEIGEVL MLGKHNKGCH CKKSGCLKKY CECFQANILC  240
SENCKCLDCK NYEGSEERQA LFHGEHANNV AYLQQAANAA ITGAVGSSGF ASSPGPKRRK  300
SQEIIFNQAT KDSSIHRFSH FQQANSGRAT GPTSCTSTVP ISRASGNASS VPSKFVYRSL  360
LADIIQPQDV KALCSVLVAV AGEAAKTLAD QRNETEKRME DQPETSLASS AAQNGGQGNK  420
GVKVEKVETG DGSSGSQVDK ARGEDSNSDG TNASKGRPLS PATLALMCDE QDTMFMVTAS  480
PNVSVDPGSH RTTSQLPNGQ GLSEIYAEQE RIVLTKFRDC LNRLISYGEL KESNCSSLAR  540
THLDSPAAVK TEAGIHQGPI PNGVSRTTTQ STAKSTSTQL TAASIPNPSN THLHKPPVLS  600
EKKDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-3013126311132Protein lin-54 homolog
5fd3_B2e-3013126311132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010526465.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526465.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4MD100.0V4MD10_EUTSA; Uncharacterized protein
STRINGXP_010526465.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein