PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010526279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 306aa    MW: 34176.4 Da    PI: 8.4132
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010526279.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.8e-54121391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePw+Lp+k+k + kewyfF  rd+ky+tg r+nrat++gyWk+tgkdke++++
  XP_010526279.1  12 LPPGFRFHPTDEELISYYLVNKIADANFTG-KAIADVDLNKSEPWELPAKAKMGGKEWYFFNLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNS 105
                     79*************************999.88***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++e vg+kktLvfy+grap+gekt Wvmheyr+
  XP_010526279.1 106 tTSEMVGMKKTLVFYRGRAPRGEKTCWVMHEYRI 139
                     78888***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6210161IPR003441NAC domain
PROSITE profilePS5100560.23312161IPR003441NAC domain
PfamPF023653.9E-2813139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEGGDQSKEE ALPPGFRFHP TDEELISYYL VNKIADANFT GKAIADVDLN KSEPWELPAK  60
AKMGGKEWYF FNLRDRKYPT GVRTNRATNT GYWKTTGKDK EIFNSTTSEM VGMKKTLVFY  120
RGRAPRGEKT CWVMHEYRIH SKSSYRTSKQ DEWVVCRVFK KSEGNRKYTS NNSTRASSTT  180
NPYPEISQNL LPLPPQSIIH PQDQTFNRIL MANTQLAELS RVFRASTSAM HPHLSYQLAG  240
EPTNMPVSGL NLNLGGGAMV QPPAPLEDAG VSGPEMGAGS SFAAEGGFGG VEMNHCMDFD  300
GYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-55516710171NO APICAL MERISTEM PROTEIN
1ut4_B1e-55516710171NO APICAL MERISTEM PROTEIN
1ut7_A1e-55516710171NO APICAL MERISTEM PROTEIN
1ut7_B1e-55516710171NO APICAL MERISTEM PROTEIN
3swm_A1e-5511679174NAC domain-containing protein 19
3swm_B1e-5511679174NAC domain-containing protein 19
3swm_C1e-5511679174NAC domain-containing protein 19
3swm_D1e-5511679174NAC domain-containing protein 19
3swp_A1e-5511679174NAC domain-containing protein 19
3swp_B1e-5511679174NAC domain-containing protein 19
3swp_C1e-5511679174NAC domain-containing protein 19
3swp_D1e-5511679174NAC domain-containing protein 19
4dul_A1e-55516710171NAC domain-containing protein 19
4dul_B1e-55516710171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010526279.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526278.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
RefseqXP_010526279.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FRV42e-78NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLQ9ZQ251e-150Q9ZQ25_ARATH; NAC domain containing protein 38
STRINGXP_010526278.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-144NAC domain containing protein 38
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Shinohara N,Ohbayashi I,Sugiyama M
    Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration.
    Front Plant Sci, 2014. 5: p. 159
    [PMID:24808900]
  3. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  4. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  5. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  6. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  7. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  8. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]