PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 317aa    MW: 35069.3 Da    PI: 8.8794
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525866.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.7e-55111381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++
  XP_010525866.1  11 LPPGFRFHPTDEELISYYLMNKIADANFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNS 104
                     79*************************999.88***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++elvg+kktLvfy+grap+gekt+Wvmheyr+
  XP_010525866.1 105 tTSELVGMKKTLVFYRGRAPRGEKTSWVMHEYRI 138
                     78889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6310160IPR003441NAC domain
PROSITE profilePS5100561.13311160IPR003441NAC domain
PfamPF023658.0E-2912138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEGNQDKGEA LPPGFRFHPT DEELISYYLM NKIADANFTG KAIADVDLNK SEPWELPEKA  60
KMGGKEWYFF SLRDRKYPTG VRTNRATNTG YWKTTGKDKE IFNSTTSELV GMKKTLVFYR  120
GRAPRGEKTS WVMHEYRIHS KSSYRTSRQD EWVVCRVFKK SEGTKKYTTN NHTTRASSTT  180
NPYIEISPNL LPPPPQSLIH SQDHTFNRTL MANAQLAELS RFFRASTSAM AAAGPMGSQQ  240
TLQHQLSYQL AGGPSNLPGS GLNLNLGGAP VPLEDVAVGE PGMGGGGSTS FAVAENGFGG  300
GVEMNHCMDL DGYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-561016619174NAC domain-containing protein 19
3swm_B2e-561016619174NAC domain-containing protein 19
3swm_C2e-561016619174NAC domain-containing protein 19
3swm_D2e-561016619174NAC domain-containing protein 19
3swp_A2e-561016619174NAC domain-containing protein 19
3swp_B2e-561016619174NAC domain-containing protein 19
3swp_C2e-561016619174NAC domain-containing protein 19
3swp_D2e-561016619174NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525866.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525866.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A087GRY21e-141A0A087GRY2_ARAAL; Uncharacterized protein
STRINGXP_010525866.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-133NAC domain containing protein 38