PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525638.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 270aa    MW: 29957.1 Da    PI: 9.3803
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525638.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32113166255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010525638.1 113 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 166
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.52E-15110166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28111166IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-24113166IPR006447Myb domain, plants
PfamPF002494.0E-7114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MLRPNAKPVG ASASLPDLSL QISPPNHSVG ERISTSSDSG STLSDLSHEN VNNNNTLLGV  60
GFDHHRHHHH HHHHHHHHNR HIYQPQIYGR DFKRSSSSSR APMVGVKRSI RAPRMRWTST  120
LHAHFVHAVQ LLGGHERATP KSVLELMNVK DLTLAHVKSH LQMYRTVKGT DKGSSGEGNG  180
EKGSEQRIGH NNNNKVDAEA DTTKPSFSPN ASSQEKTQRA YSWSSPMEPT GAKGDEGGAD  240
LQLNLEFTLG RSNWWMDYAE PGDDLTLLRC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525638.10.0PREDICTED: probable transcription factor KAN4
SwissprotQ9FJV52e-97KAN4_ARATH; Probable transcription factor KAN4
TrEMBLD7MS191e-95D7MS19_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.8__589__AT5G42630.14e-95(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.12e-85G2-like family protein