PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 272aa    MW: 31470.2 Da    PI: 7.8905
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525613.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.31.8e-5091342128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                      pGfrFhPtdeelv +yL++k+e+k++++ e ik++diyk++PwdLpk  + +ekewyf++ r +ky+++ r+nr+t sg+Wkatg dk+v+s +
  XP_010525613.1   9 LPGFRFHPTDEELVGFYLRRKIENKPIRF-ELIKHIDIYKFDPWDLPKVNSVGEKEWYFYCMRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSDN 102
                     69**************************9.99***************76667999**************************************99 PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     +  +glkk+Lv+y g+a kg+ktdW+mhe+rl
  XP_010525613.1 103 HDCIGLKKSLVYYLGSAGKGSKTDWMMHEFRL 134
                     999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.1938162IPR003441NAC domain
SuperFamilySSF1019417.72E-568161IPR003441NAC domain
PfamPF023658.8E-2510134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGVEDGDTLP GFRFHPTDEE LVGFYLRRKI ENKPIRFELI KHIDIYKFDP WDLPKVNSVG  60
EKEWYFYCMR GRKYRNSIRP NRVTGSGFWK ATGIDKPVYS DNHDCIGLKK SLVYYLGSAG  120
KGSKTDWMMH EFRLPTNAKS GSTDDNSPQQ AEVWTLCRIF KRTTRQRQPI FIPNQKPVIS  180
LTDSCSNTSS LDSDHSSRRR HAAGDHLPYE LHEPQQNRCH VDLQHPPVPA PPFSCNDNNF  240
PHVWNMNGGD YFIADEGSWD ELRSVVQGYS ER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-5011684171NO APICAL MERISTEM PROTEIN
1ut4_B3e-5011684171NO APICAL MERISTEM PROTEIN
1ut7_A3e-5011684171NO APICAL MERISTEM PROTEIN
1ut7_B3e-5011684171NO APICAL MERISTEM PROTEIN
3swm_A3e-5011687174NAC domain-containing protein 19
3swm_B3e-5011687174NAC domain-containing protein 19
3swm_C3e-5011687174NAC domain-containing protein 19
3swm_D3e-5011687174NAC domain-containing protein 19
3swp_A3e-5011687174NAC domain-containing protein 19
3swp_B3e-5011687174NAC domain-containing protein 19
3swp_C3e-5011687174NAC domain-containing protein 19
3swp_D3e-5011687174NAC domain-containing protein 19
4dul_A3e-5011684171NAC domain-containing protein 19
4dul_B3e-5011684171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525613.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525613.10.0PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK551e-123NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A397ZX501e-131A0A397ZX50_BRACM; Uncharacterized protein
STRINGXP_010525613.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-110NAC domain containing protein 42
Publications ? help Back to Top
  1. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  2. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  3. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  4. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]