PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 464aa    MW: 52392.4 Da    PI: 5.299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.7e-5091371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp+G+rF+Ptdeelv +yL+ k++g++ ++ ++i+evdi+k+ePwdLp  + vk++++ew fF++ d+ky++g+r nrat +gyWkatgkd++v+
  XP_010525539.1   9 LPVGLRFRPTDEELVRYYLRLKINGHDDDV-RIIREVDICKWEPWDLPdlSVVKTKDSEWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRNVK 102
                     799************************999.89**************96448888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s k++ +g+k+tLvfy+grapkg++t Wvmheyr+
  XP_010525539.1 103 SVKNSIIGVKRTLVFYTGRAPKGTRTCWVMHEYRA 137
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-567160IPR003441NAC domain
PROSITE profilePS5100554.2199160IPR003441NAC domain
PfamPF023653.5E-2410136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEDLLLDSLP VGLRFRPTDE ELVRYYLRLK INGHDDDVRI IREVDICKWE PWDLPDLSVV  60
KTKDSEWLFF CPLDRKYPNG SRMNRATVAG YWKATGKDRN VKSVKNSIIG VKRTLVFYTG  120
RAPKGTRTCW VMHEYRATEK DLDGMKPGQS PFVICKLFKK QDENPTAEDS KSDEVETLVS  180
SPAIAKSSAD ESKSDESRAL ETCERKPFEV SESSLVAIAE CHSDQSDTCD QPAKVTFTEI  240
EDLKWLPVEM ESLDFKMFSP LHSQVQSELG SSFNAFRSGS DNLFSNHDGL QIQTQYGTNY  300
EDAFMSEFLD SILVNPDEFS GTVAPPVQEQ VIQAYLDPDN CTDVYERGIT IRARRSPQSQ  360
ACIGNVLMAQ GTAPRRLLLQ RKLDGLESGP ENHPRLQHIK KEVDDMVTEI SRKGREKYVR  420
RNNTGFIFKK IASMTTCSYG GLLKAAVVAV VFLTSICGPM ADIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-45816116166NO APICAL MERISTEM PROTEIN
1ut4_B4e-45816116166NO APICAL MERISTEM PROTEIN
1ut7_A4e-45816116166NO APICAL MERISTEM PROTEIN
1ut7_B4e-45816116166NO APICAL MERISTEM PROTEIN
3swm_A4e-45816119169NAC domain-containing protein 19
3swm_B4e-45816119169NAC domain-containing protein 19
3swm_C4e-45816119169NAC domain-containing protein 19
3swm_D4e-45816119169NAC domain-containing protein 19
3swp_A4e-45816119169NAC domain-containing protein 19
3swp_B4e-45816119169NAC domain-containing protein 19
3swp_C4e-45816119169NAC domain-containing protein 19
3swp_D4e-45816119169NAC domain-containing protein 19
4dul_A4e-45816116166NAC domain-containing protein 19
4dul_B4e-45816116166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:20156199, PubMed:19947982). Transcriptional activator involved in response to cold stress. Mediates induction of pathogenesis-related (PR) genes independently of salicylic signaling in response to cold. Binds directly to the PR gene promoters and enhances plant resistance to pathogen infection, incorporating cold signals into pathogen resistance responses (PubMed:19947982). Plays a regulatory role in abscisic acid (ABA)-mediated drought-resistance response (PubMed:22967043). {ECO:0000269|PubMed:19947982, ECO:0000269|PubMed:20156199, ECO:0000269|PubMed:22967043}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525539.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt, drought stress, abscisic acid (ABA), salicylic acid (SA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525539.10.0PREDICTED: NAC domain-containing protein 62-like
SwissprotQ9SCK61e-175NAC62_ARATH; NAC domain-containing protein 62
TrEMBLV4L5I21e-180V4L5I2_EUTSA; Uncharacterized protein
STRINGXP_010525540.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-159NAC domain containing protein 62
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]