PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 368aa    MW: 40148.6 Da    PI: 6.3553
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525409.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10159217563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se+
  XP_010525409.1 159 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTNGLSSEN 217
                     9*****************************************99998887777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-17155219IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691157220IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-8157213No hitNo description
PfamPF001701.9E-9159217IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.66E-10159210No hitNo description
CDDcd147031.28E-23160209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MEDPSNAKPN PSNHHRPQCP TPPLANPSAV PPAPTPTPFR GPYHRRAHSE VQFRLPEDMD  60
LSDPFGGFDD LGSEDDLFCS YMDIEKLGSG SGSASDSAGL RSDNPLLGEN GGGGFDEAGN  120
SKPRHRHSLS VDGSSLESIE AKKAMAPDKL AELWVADPKR AKRIIANRQS AARSKERKAR  180
YILELERKVQ TLQTEATTLS AQLSLFQRDT NGLSSENTEL KVRLQTMEQH AKLRDELNEE  240
LKKEIDRLKF VTGETHGDAY NLGIAPGCMQ YPQSFFQPLT RAAASPSNAQ NMQMAPQQFH  300
LFRPNNGIPN SANMTASAHQ PLLNSFSEAM QYDPLGRLQG LDISSCGRGG SNFGGRPSDS  360
VSESSSTM
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525409.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525409.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228731e-162BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A1J3EZH91e-165A0A1J3EZH9_NOCCA; Transcription factor RF2b (Fragment)
TrEMBLA0A1J3GSQ41e-165A0A1J3GSQ4_NOCCA; Transcription factor RF2b
STRINGXP_010525409.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-146bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]