PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family CPP
Protein Properties Length: 651aa    MW: 70803 Da    PI: 4.7818
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525316.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.12.7e-16367405240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_010525316.1 367 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 405
                     689**********************************96 PP

2TCR52.31.1e-16452490139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  XP_010525316.1 452 RHKRGCNCKKSSCLKKYCECFQGGVGCSVNCRCEGCKNA 490
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19366407IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.6367492IPR005172CRC domain
PfamPF036387.1E-12369404IPR005172CRC domain
SMARTSM011141.7E-17452493IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.0E-12454490IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MDTPQKTAAQ IGTPISKSKF EDSPVFNYIN SLSPIKSVKS IPIAQTFGSL SFSSPPSVFT  60
SPHVNSHNES RFFRSHPPPK PEAKSRDGSS AIEEVVTAPE NFSAEASMEE EEAASIEPSN  120
GNFETEPIGD RDSSEVVAMD LQKMCNVKSS KNDTPDWESL ISDSTDLLIF SSPNDSEAFR  180
DLIQPHANNF TSDDPSNGED NESAESDSTD LLIFSSPNDS EAFRDLIQPH ANNFTSDDPS  240
NGEDNESAEA VSNFHRGLRR RCLDFVSPSE PSSRCILPSI GLHLNAIAMS SKDSKASLLN  300
EYSFPGKIHV SLPGANTHSK ENVQETRDED ASQEVEDVSK ASVSEELNPS SPKKKRRKFD  360
QGGEGESCKR CNCKKSKCLK LYCECFAAGV YCIEPCSCVD CFNKPIHEDT VLATRKQIES  420
RNPLAFAPKV IRSSDPISEA GDDASKTPAS ARHKRGCNCK KSSCLKKYCE CFQGGVGCSV  480
NCRCEGCKNA FGRKDGSSGI GSEGEQEEEN DTSEKYVTAK AQQNPEIFNE EEQNQSSGLP  540
STPLPLYRQP LVQLPFPSNN QTVSQSLLGA GSSSSRQFNS FETISEDGTE DDMPEILVRS  600
PIPTVKAVSP NSKRVSPPNL DSSGSILGRR NGGRKLILQS IPSFPSLTPH Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1637148914120Protein lin-54 homolog
5fd3_B2e-1637148914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1352356KKKRR
2352357KKKRRK
3353357KKRRK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525316.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019056707.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_010525316.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]