PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525243.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 345aa    MW: 38895.5 Da    PI: 6.6013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525243.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52111391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv++ +++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010525243.1  11 VPPGFRFHPTEEELLQYYLRKKVSNIEIDL-DVIRDVDLNKLEPWDIQEscKIGTtPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKNI 104
                     69****************************.9***************963433332456************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +s +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  XP_010525243.1 105 CS-NGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                     **.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-588171IPR003441NAC domain
PROSITE profilePS5100556.97411171IPR003441NAC domain
PfamPF023655.0E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MNISVNGQSQ VPPGFRFHPT EEELLQYYLR KKVSNIEIDL DVIRDVDLNK LEPWDIQESC  60
KIGTTPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKNICSNGRR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLH DNSSPTDPTV ASIIGEASQE EGWVVCRIFK KKNLHKTLNS  180
PAKSCLNGGD AAARTTPSQM FNEETIEQFL EIMGRSCKEE LNIDPSMKLP NLDSPSSNVT  240
TSYQRLMEDR DGPISNCHVG AIDTSFVTSW AALDRLYSTP TVDESPFDDH LVLPTVRSSF  300
PGLNRSGSSQ TDLAQDFAPE MELWRPAFGR TTSSLSSSSD TLYHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-4951739170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525243.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525243.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-174NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A178VUZ51e-171A0A178VUZ5_ARATH; NST1
STRINGXP_010525243.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-165NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]