PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 405aa    MW: 45119.3 Da    PI: 10.9433
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525080.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.2e-32238291255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010525080.1 238 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 291
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15235292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28236292IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-24238292IPR006447Myb domain, plants
PfamPF002495.8E-7239290IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MPQEGVFIHK LPKPSNPLPD LSLHISLPAD SSKSLESSPR SHPDNDDISR IELSLAHPTT  60
CSDNTSPRNS RFFHGGLDTD HSATSHHHQQ QLHYPINGGL HGLSHLINQR VSSSPENLHR  120
PIRGIPVYHN RSFPFYHPMP SSSSSSPSSS LPCFGGEFDQ VSILSSSAAN NQSFPGYNSY  180
RVQAGSRLKG VASSIEALRS HHLHHHHYGV GSSDSSSHGM IRSRFLPKLP TKRSMRAPRM  240
RWTSSLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TIKSTNKPAA  300
SSGANQMGLG TKILPLLETG QIKEHNLIIK KLTSLPPSPR LSGVILQAER HGRRVMLKQR  360
EEVHQHHSVT IKLHQLSKLR RIIAREMEKR GVEVLVARIR AWSSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525080.10.0PREDICTED: transcription repressor KAN1-like isoform X2
SwissprotQ93WJ93e-79KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A078C3255e-84A0A078C325_BRANA; BnaA10g17920D protein
TrEMBLA0A078GU045e-85A0A078GU04_BRANA; BnaC09g32160D protein
STRINGBra008613.1-P8e-83(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-79G2-like family protein