PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 410aa    MW: 44952.4 Da    PI: 7.5678
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525079.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32238291255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010525079.1 238 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 291
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15235292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28236292IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-24238292IPR006447Myb domain, plants
PfamPF002495.9E-7239290IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MPQEGVFIHK LPKPSNPLPD LSLHISLPAD SSKSLESSPR SHPDNDDISR IELSLAHPTT  60
CSDNTSPRNS RFFHGGLDTD HSATSHHHQQ QLHYPINGGL HGLSHLINQR VSSSPENLHR  120
PIRGIPVYHN RSFPFYHPMP SSSSSSPSSS LPCFGGEFDQ VSILSSSAAN NQSFPGYNSY  180
RVQAGSRLKG VASSIEALRS HHLHHHHYGV GSSDSSSHGM IRSRFLPKLP TKRSMRAPRM  240
RWTSSLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TIKSTNKPAA  300
SSDGSGDEDT PASGNGTDQR AQSDHQEIDF PSAISTPLWC NSSSGEAWPQ SNVETTRGGT  360
SASFSHHQIT STLQTEEDHS SRDGEKRCGG LSGKNPSLEF TLGRPDWHEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525079.10.0PREDICTED: transcription repressor KAN1-like isoform X1
SwissprotQ93WJ91e-114KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A078C3251e-122A0A078C325_BRANA; BnaA10g17920D protein
STRINGAT5G16560.11e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-113G2-like family protein