PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 482aa    MW: 55882.4 Da    PI: 5.701
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525037.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.1e-5561331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeel+++yLk+k++g++++l ++i+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v 
  XP_010525037.1   6 LPPGFRFHPTDEELITYYLKRKINGREIDL-DIIPEVDLYKCEPWDLPgKsLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVS 99 
                     79****************************.99***************6345667999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++++g+kktLv+y+grap+g +t W+mheyrl
  XP_010525037.1 100 W-RNRAIGTKKTLVYYRGRAPHGIRTGWIMHEYRL 133
                     9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-623157IPR003441NAC domain
PROSITE profilePS5100560.0896157IPR003441NAC domain
PfamPF023655.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MAAVSLPPGF RFHPTDEELI TYYLKRKING REIDLDIIPE VDLYKCEPWD LPGKSLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RNRAIGTKKT LVYYRGRAPH  120
GIRTGWIMHE YRLDETECEL SALGMLDAYA LCRVSKKIVI EGKPREMSSY VHTRAMIGDC  180
SSNLDVCSYP DSSTHQIQPY HQFGGGRDDD WARYLPQEAF PLPNHGSSYD PYPPLSKVNS  240
EIECAMLQHQ MSLPPLRIES SPQTNEYFKV NQNNDHGFED FTFATSNFNH YNNDPFIPVF  300
GNLDDGFNAE NSRWMRTPNN DTNHHDFVEE HKIMPNFEDN NEFDGESRCN AINSNIDIED  360
YLSFEIYHVK DEKQVGEVDA AINTNETLIS SSFEMVEEEI KVNHGMFIAT RQATETLFHQ  420
IVPSETLKVQ INALDDRLEE RRALSEDYSD SLFDKIKRSA KARLSKVHLI AHQYYMSIRV  480
FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-54115712165NO APICAL MERISTEM PROTEIN
1ut4_B6e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_A6e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_B6e-54115712165NO APICAL MERISTEM PROTEIN
3swm_A6e-54115715168NAC domain-containing protein 19
3swm_B6e-54115715168NAC domain-containing protein 19
3swm_C6e-54115715168NAC domain-containing protein 19
3swm_D6e-54115715168NAC domain-containing protein 19
3swp_A6e-54115715168NAC domain-containing protein 19
3swp_B6e-54115715168NAC domain-containing protein 19
3swp_C6e-54115715168NAC domain-containing protein 19
3swp_D6e-54115715168NAC domain-containing protein 19
3ulx_A7e-54215711168Stress-induced transcription factor NAC1
4dul_A6e-54115712165NAC domain-containing protein 19
4dul_B6e-54115712165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010525037.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525037.10.0PREDICTED: NAC domain-containing protein 45-like
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLV4N7S30.0V4N7S3_EUTSA; Uncharacterized protein
STRINGXP_010525037.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.10.0NAC domain containing protein 45
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]