PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010524963.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 354aa    MW: 40155.5 Da    PI: 7.5716
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010524963.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.87.6e-52101451128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yL+kk+++++    ++i++vdiyk++PwdLp+k+  +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk + ++
  XP_010524963.1  10 LPPGFRFHPTDEELILHYLRKKISSSHQVPVSIIADVDIYKFDPWDLPAKAPYGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKVIAAA 104
                     79*********************9999555589***************988889**************************************998 PP

             NAM  96 ....kgel......vglkktLvfykgrapkgektdWvmheyrl 128
                         +         +g+kk Lvfykg+ pkg kt+W+mheyrl
  XP_010524963.1 105 anggE--IhrpvekIGVKKALVFYKGKPPKGIKTNWIMHEYRL 145
                     76550..1455556***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-607181IPR003441NAC domain
PROSITE profilePS5100560.57510181IPR003441NAC domain
PfamPF023657.0E-2811145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MISKDPRSSL PPGFRFHPTD EELILHYLRK KISSSHQVPV SIIADVDIYK FDPWDLPAKA  60
PYGEKEWYFF SPRDRKYPNG ARPNRAAASG YWKATGTDKV IAAAANGGEI HRPVEKIGVK  120
KALVFYKGKP PKGIKTNWIM HEYRLVDSLS PSRLSGCDRG LRSKESSMRL DDWVLCRIYK  180
KTQASPAFMA ATSDQEQEQE EDEEVSITGQ TLLPRLPQLT FPSIMSNDNT LKPPKSSCSF  240
SNPSDPGDLM FLSGFLADNP ENQTEFEFPL MFGSSDLDYG NGYLDQKLPR LTSPPLEKLG  300
TDNKRQRTDF VDEKMNPLKK TMNICGYNNN TMDQFDHSFM NQQLLLSPHL QFQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-70918516169NO APICAL MERISTEM PROTEIN
1ut4_B1e-70918516169NO APICAL MERISTEM PROTEIN
1ut7_A1e-70918516169NO APICAL MERISTEM PROTEIN
1ut7_B1e-70918516169NO APICAL MERISTEM PROTEIN
3swm_A1e-70918519172NAC domain-containing protein 19
3swm_B1e-70918519172NAC domain-containing protein 19
3swm_C1e-70918519172NAC domain-containing protein 19
3swm_D1e-70918519172NAC domain-containing protein 19
3swp_A1e-70918519172NAC domain-containing protein 19
3swp_B1e-70918519172NAC domain-containing protein 19
3swp_C1e-70918519172NAC domain-containing protein 19
3swp_D1e-70918519172NAC domain-containing protein 19
4dul_A1e-70918516169NAC domain-containing protein 19
4dul_B1e-70918516169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010524963.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010524963.10.0PREDICTED: NAC domain-containing protein 18-like
SwissprotQ84TD61e-152NAC47_ARATH; NAC transcription factor 47
TrEMBLD7L2131e-153D7L213_ARALL; ANAC047
STRINGXP_010524963.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77232540
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-149NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]