PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010524068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 302aa    MW: 33737.4 Da    PI: 7.4668
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010524068.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.52e-3049102255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp LH +Fv+ave+LGG++kAtPk +l lm++kgL+++hvkSHLQ+YR+
  XP_010524068.1  49 PRLRWTPSLHLAFVHAVERLGGPHKATPKLVLGLMNLKGLSIAHVKSHLQMYRS 102
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.90545105IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-2845103IPR009057Homeodomain-like
SuperFamilySSF466891.02E-1248103IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2149104IPR006447Myb domain, plants
PfamPF002491.1E-750101IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MATFDLNREA VENGEEEEEE EDQTWPSCGN DNEEGRTSTV RQYVRSSMPR LRWTPSLHLA  60
FVHAVERLGG PHKATPKLVL GLMNLKGLSI AHVKSHLQMY RSKKLDESSN AARPGMINGK  120
TMRKSGSLLE MLNYGYIPYG EFRHVYNSEA ILTRELELRS GNQELLMVNP AKGVLADLGV  180
NRLVQPSGLC SGFNGNQWRP VSRSCDGDDS ECKTLPLLEI KKTTGEKRRR DKAQLSEELE  240
VIKQAKIISR EGNLLPELGL SLCQAFGSCR KQKLGEDIKT MLVLSLFPTS SGDQNMTSNI  300
ET
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010524068.10.0PREDICTED: uncharacterized protein LOC104802260 isoform X1
TrEMBLA0A087H4R21e-67A0A087H4R2_ARAAL; Myb family transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.13e-63G2-like family protein