PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 275aa    MW: 31372.9 Da    PI: 4.8488
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523852.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1492.3e-4681363128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     +Gf F+Ptd+el+ +yL+ k  g++++++e+i+e++iy+++PwdL+ + k+++ +++ w+fFs+r++ky+++kr+nr+t++gyWk tg+d++++ 
  XP_010523852.1   8 KGFGFRPTDQELIEDYLNYKNLGDDTPVHEAINEINIYRFDPWDLRgQsKIQSeDDQIWHFFSPRNTKYSKSKRSNRKTENGYWKVTGRDRSIKG 102
                     7***************************9****************85246666245589************************************ PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++++g+kktLvfy+gr p+g ktdWvmhey+ 
  XP_010523852.1 103 TSKKVIGTKKTLVFYRGRVPSGIKTDWVMHEYHS 136
                     ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100545.3076161IPR003441NAC domain
SuperFamilySSF1019419.94E-468137IPR003441NAC domain
PfamPF023651.1E-238135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MVLKWKMKGF GFRPTDQELI EDYLNYKNLG DDTPVHEAIN EINIYRFDPW DLRGQSKIQS  60
EDDQIWHFFS PRNTKYSKSK RSNRKTENGY WKVTGRDRSI KGTSKKVIGT KKTLVFYRGR  120
VPSGIKTDWV MHEYHSSALT PDKTIGQAEE TPNSVCNTGG FDTDLGLMWD ELDEESPMLD  180
SILLNDFSFI DNIPLLSEFC SPLEDLEVET QSMPQFANSV SANHSSETVH SQMQSDLITW  240
SCPDHSSNID SETVSLWMNQ CSPGASAGER SFNTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-35913518139Stress-induced transcription factor NAC1
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010523852.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523852.10.0PREDICTED: NAC transcription factor 29-like isoform X3
STRINGXP_010523847.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.24e-41NAC 014