PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 424aa    MW: 48771.7 Da    PI: 7.0716
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523429.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.7e-50631882128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++
  XP_010523429.1  63 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSET 156
                     79***************************.89***************8778899***************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +glkktLvfy+g+apkg +t+W+m+eyrl
  XP_010523429.1 157 SRPIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 188
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5662209IPR003441NAC domain
PROSITE profilePS5100556.1162209IPR003441NAC domain
PfamPF023655.5E-2564188IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MAVVSSTTGI ITMSSNVSNG DFHHDRSSNS DKGVEDDDRR GHEGHDDNND DDDDDDHGHD  60
MVMPGFRFHP TEEELIEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAL AAIGEKEWYF  120
YVPRDRKYRN GDRPNRVTTS GYWKATGADR MIRSETSRPI GLKKTLVFYS GKAPKGIRTS  180
WIMNEYRLPH HETEKHQKAE ISLCRVYKRP GVEDHPSLPR SLPTRHHRHH HNASSSSSPP  240
SSRLALRQQN PSSSATFPNS SNSSNNTNTR RTKTDNSNSD VTMALVSHQP QQQEQQRHQN  300
IYRPMPYVTS NPVISTMAAE DESVFVNNSV DELQRLVNYQ ISVSDSSNIN QQYYQIAQQF  360
HHHHQQPQQQ QQQNALHLMA AATTLTPQTQ TMNVIPGTMP NNAFPDRLWE VWNHIDCSNI  420
GPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-556420919165NO APICAL MERISTEM PROTEIN
1ut4_B1e-556420919165NO APICAL MERISTEM PROTEIN
1ut7_A1e-556420919165NO APICAL MERISTEM PROTEIN
1ut7_B1e-556420919165NO APICAL MERISTEM PROTEIN
3swm_A1e-556420922168NAC domain-containing protein 19
3swm_B1e-556420922168NAC domain-containing protein 19
3swm_C1e-556420922168NAC domain-containing protein 19
3swm_D1e-556420922168NAC domain-containing protein 19
3swp_A1e-556420922168NAC domain-containing protein 19
3swp_B1e-556420922168NAC domain-containing protein 19
3swp_C1e-556420922168NAC domain-containing protein 19
3swp_D1e-556420922168NAC domain-containing protein 19
4dul_A1e-556420919165NAC domain-containing protein 19
4dul_B1e-556420919165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010523429.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523429.10.0PREDICTED: NAC domain-containing protein 35
SwissprotQ9ZVP81e-164NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A0D3E7K31e-165A0A0D3E7K3_BRAOL; Uncharacterized protein
STRINGXP_010523429.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-117NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]