PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523175.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 363aa    MW: 39661.6 Da    PI: 8.0025
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523175.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.57e-29148202156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     kp+++WtpeLH++Fv+aveqL G ekA+P++ile+m+v++Lt+++v+SHLQkYR++
  XP_010523175.1 148 KPKVDWTPELHRKFVQAVEQL-GVEKAVPSRILEIMNVQSLTRHNVASHLQKYRSH 202
                     79*******************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.944145204IPR017930Myb domain
SuperFamilySSF466893.05E-19146205IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28146205IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-26148202IPR006447Myb domain, plants
PfamPF002494.0E-8151200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MMLAAASPLI HTARDGHRSS PAAVVDFAGF TAEDLPEFSA TGKEEESSLD LLEGIDYFDY  60
LFVGIGQGDE LPDLEIDPEM LGEYSGGGRD DTEANTSTET AEKGGGSKPE VTSNADGDGH  120
TVKTVRRGKN SKHRGKNKDG DKSEAKKKPK VDWTPELHRK FVQAVEQLGV EKAVPSRILE  180
IMNVQSLTRH NVASHLQKYR SHRKHLLARE AEAANWNLRR QATVAGGGGG GKKPWAAPAL  240
GYPHVHHFPR PLHVWGHPTW PNHKPPVASA APPSWAVPPA TPNPTYWAHQ QPVYPQGYGI  300
PPPNHRIYKS ETSIGVPTAP LRPIDLHPSN ESIDAAIGDV MSKPWLPRCI VKLPKSITMT  360
LER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19145200257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523175.10.0PREDICTED: transcription activator GLK2
SwissprotQ9FFH01e-115GLK2_ARATH; Transcription activator GLK2
TrEMBLA0A087GP571e-123A0A087GP57_ARAAL; Uncharacterized protein
STRINGBra036015.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.11e-113GOLDEN2-like 2