PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 361aa    MW: 40861.5 Da    PI: 7.5307
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.4e-56161421129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv ++ +++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010523106.1  16 LPPGFRFHPTDEELITHYLHEKVLDSGFSA-KAIGEVDLNKSEPWELPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIHR- 108
                     79***************************9.89***************888999***************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfy+grapkg+kt+Wvmhe+rle
  XP_010523106.1 109 RKSLVGMKKTLVFYRGRAPKGQKTNWVMHEFRLE 142
                     999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6112151IPR003441NAC domain
PROSITE profilePS5100556.57816194IPR003441NAC domain
PfamPF023653.9E-2917141IPR003441NAC domain
SuperFamilySSF1019411.57E-61182194IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEPICGFDKE DEQMDLPPGF RFHPTDEELI THYLHEKVLD SGFSAKAIGE VDLNKSEPWE  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIHRRK SLVGMKKTLV  120
FYRGRAPKGQ KTNWVMHEFR LEGKLSAHNL PKTAKVKANL CSVLLVCFRL SISVLVWSAL  180
VWQNEWVVCR VFQKSAGGNK IPISGLIRIG SFKTGLDPSS LPPLTDFSSL YNDKTKPEPV  240
VYVPCFSNPT ENQGNTVLNS VQTNVLPRIP LHQSHSVPVS EDLQSPNPDL IQEQTVLRAM  300
MIENSGRQSF KTSSVSQETG VSTEINTDVS SDFEFGLRQF DPREEPSSSA GPADIESFWI  360
Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-511320017174NAC domain-containing protein 19
3swm_B7e-511320017174NAC domain-containing protein 19
3swm_C7e-511320017174NAC domain-containing protein 19
3swm_D7e-511320017174NAC domain-containing protein 19
3swp_A7e-511320017174NAC domain-containing protein 19
3swp_B7e-511320017174NAC domain-containing protein 19
3swp_C7e-511320017174NAC domain-containing protein 19
3swp_D7e-511320017174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010523106.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523106.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
SwissprotQ9FLJ20.0NC100_ARATH; NAC domain-containing protein 100
TrEMBLD7MV190.0D7MV19_ARALL; ANAC100/ATNAC5
STRINGXP_010523106.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.10.0NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]