PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010522110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family LBD
Protein Properties Length: 221aa    MW: 25258.1 Da    PI: 9.3554
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010522110.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.13.2e-3418116199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++r+kC++dCvlapyfp+ ++k+f++vh++FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G +g +++++++l+  k  ++
  XP_010522110.1  18 ACASCKHQRKKCNSDCVLAPYFPSYKTKEFQAVHRVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGLYGEYRRIHEELKLYKGFIH 112
                     7*************************************************************************************999887766 PP

          DUF260  96 llke 99 
                     + ++
  XP_010522110.1 113 HHQQ 116
                     6665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.90517118IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-3218109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MMQRDCETGN NTSTHHQACA SCKHQRKKCN SDCVLAPYFP SYKTKEFQAV HRVFGVSNVQ  60
KMVRTVREED RTKLSDSLTW EALWRQKDPV LGLYGEYRRI HEELKLYKGF IHHHQQHLVN  120
WDNISIGNHH VFSGNNNNSS KTGLVVDYAS GSGGFGLNNG NNGVISDHNG AGVNRVENNG  180
GYSSRNLLGG WDKFKQQQQQ QQQCYAVVND FKQRYPLSHK F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-1881181112LOB family transfactor Ramosa2.1
5ly0_B7e-1881181112LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010522110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010522110.11e-166PREDICTED: LOB domain-containing protein 2
RefseqXP_019056628.11e-166PREDICTED: LOB domain-containing protein 2
RefseqXP_019056629.11e-166PREDICTED: LOB domain-containing protein 2
SwissprotQ9LNB92e-84LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ12e-85V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_010522110.11e-166(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.14e-77LOB domain-containing protein 2