PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 394aa    MW: 43965.3 Da    PI: 4.4307
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521060.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1561.7e-4861341129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtd elv++yLk+kv gkkl + e+i+e+diyk+eP+dLp k ++++++ +wyfF++r++ky +g r nrat+ gyWk tgkd++vl
  XP_010521060.1   6 LAPGFRFHPTDVELVKYYLKRKVMGKKLLV-EAIAEIDIYKFEPSDLPdKsCLRTGDLKWYFFCPRERKYGNGVRMNRATEYGYWKMTGKDRAVL 99 
                     579************************999.89**************96347788999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + ++e+vg  ktLv++ g++p+ge+tdWvmheyrle
  XP_010521060.1 100 C-NNEVVGKIKTLVYHCGKSPRGERTDWVMHEYRLE 134
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-594156IPR003441NAC domain
PROSITE profilePS5100553.4636156IPR003441NAC domain
PfamPF023655.2E-268133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MVKTHLAPGF RFHPTDVELV KYYLKRKVMG KKLLVEAIAE IDIYKFEPSD LPDKSCLRTG  60
DLKWYFFCPR ERKYGNGVRM NRATEYGYWK MTGKDRAVLC NNEVVGKIKT LVYHCGKSPR  120
GERTDWVMHE YRLEDKGLAQ KDVVQDSYVL CVLFKKDGPG PRNGAQYGAP FKEEEWSDGE  180
ENTENVAALP STESPIYLPG MNRETSLVAT TSQAPKDFCG GRVSESCVSD VIATANMSLP  240
LNYADNTPLL DPNSIPTLEE ATQIPGDDIY SMLDYFVDDE SFGFGGYSQN EAGHEEPGVC  300
RDGELPLCSA ADDIFSGQPA PRDLAPGYNE NTPFFLELED LTEPLTFPGN TDSIHLIQDR  360
FGFSADDPSS CFVPTQPQPQ LQPSQPLSGD LKEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-45515614168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010521060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521054.10.0PREDICTED: NAC domain-containing protein 82-like
RefseqXP_010521060.10.0PREDICTED: NAC domain-containing protein 82-like
SwissprotQ9FY821e-135NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A3P6E4B01e-137A0A3P6E4B0_BRAOL; Uncharacterized protein
STRINGXP_010521054.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-138NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]