PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TALE
Protein Properties Length: 662aa    MW: 73080.6 Da    PI: 6.7586
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521016.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093934301954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_010521016.1 393 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 430
                     554459******************************88 PP

2BELL127.55e-41252323172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+s+l+eVd+rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLkdai++qi
  XP_010521016.1 252 ERQEIQMKKAKLISMLHEVDQRYRQYHHQMQIVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKDAISGQI 323
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-68173321IPR006563POX domain
PfamPF075261.1E-48179320IPR006563POX domain
PROSITE profilePS5007112.26371434IPR001356Homeobox domain
SMARTSM003892.3E-9374438IPR001356Homeobox domain
CDDcd000862.93E-12374435No hitNo description
SuperFamilySSF466896.84E-17375440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-29377440IPR009057Homeodomain-like
PfamPF059202.7E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MAYFHGNPPE ISAATASDGG LQTLILMNPT TYIQFSDHHH HQQDDDNDNN NTNSNNFVFL  60
NPHAPPQTAT QQFVGIPLAG HHESSATAAA ELHGFLPRVQ YNLYNNNNSN NNHHVDPIAC  120
ETPRASSQQG LSLTLSSQQQ QRQQSQQQNL SFGFGPGDEI RVGSGSTVSG LTNSVVSGLL  180
SSKYLRAAQE LLDEVVNVNN SNELLLPSTT PKKASSGGXX PAGESSAGVG EGSGGGGGDV  240
TGKRVAELST AERQEIQMKK AKLISMLHEV DQRYRQYHHQ MQIVISSFEQ AAGIGSAKSY  300
TSLALKTISR QFRCLKDAIS GQIETANKSL GEEESVSGGG RFEGSRLKFV DHHLRQQRAL  360
QQLGMIQHPN NNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKHMLA KQTGLTRSQV  420
SNWFINARVR LWKPMVEEMY LEEMKEQEKN NGPMDKTVDE NNEDSASKSM SNHDKSSVGA  480
EDYQLNSNLP NRNVVLEGVI GAQGSPKRLR TSDEMLMQPM NTGFNPNEKL TMKILEERQG  540
LRDGYSFVGN FGQYQMDEMP RFDVSDHQHL IVPPRTFSGN NGVSLTLGLP HCESLSATHH  600
QNFMPNHNIQ LGRRVKINGE TDDFGAMNAS ASTPHSSSVA YNGINMENQK RFVAQLLPDL  660
VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-16380438563Homeobox protein Meis2
3k2a_A1e-16380438563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521016.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A078CR560.0A0A078CR56_BRANA; BnaC03g19820D protein
STRINGBra017277.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1