PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010520901.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 304aa    MW: 34163.2 Da    PI: 6.688
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010520901.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.72e-52141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g+ ++l +vi e+d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + 
  XP_010520901.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHGFSL-QVIGEIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIISA- 106
                     79***************************9.99***************8777899*********************************999988. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  XP_010520901.1 107 EGRRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                     9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-669163IPR003441NAC domain
PROSITE profilePS5100560.93514163IPR003441NAC domain
PfamPF023652.9E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGVREKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHG FSLQVIGEID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISAEGRR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLI EPSRTNNGSS KLDEWVLCRI YKKSTGAQKQ VPGQTYRERE  180
EHSMNGSLSS SASQLDDVLD SIPEINEQFF NLPRMNSLRS LLNDDKISNL DWATLAGLNP  240
VPDLVPNYTG NNSFVAADEE AESGLRNSDG LTHGSSGYNW VESGVNSVEP FGDGFSSHGF  300
WFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10711694171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10711694171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10711694171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10711694171NO APICAL MERISTEM PROTEIN
3swm_A1e-10711697174NAC domain-containing protein 19
3swm_B1e-10711697174NAC domain-containing protein 19
3swm_C1e-10711697174NAC domain-containing protein 19
3swm_D1e-10711697174NAC domain-containing protein 19
3swp_A1e-10711697174NAC domain-containing protein 19
3swp_B1e-10711697174NAC domain-containing protein 19
3swp_C1e-10711697174NAC domain-containing protein 19
3swp_D1e-10711697174NAC domain-containing protein 19
4dul_A1e-10711694171NAC domain-containing protein 19
4dul_B1e-10711694171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010520901.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010520901.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ93VY31e-153NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A1J3CQY21e-153A0A1J3CQY2_NOCCA; NAC domain-containing protein 72
STRINGXP_010520901.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-155NAC family protein
Publications ? help Back to Top
  1. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  2. Li S, et al.
    The role of ANAC072 in the regulation of chlorophyll degradation during age- and dark-induced leaf senescence.
    Plant Cell Rep., 2016. 35(8): p. 1729-41
    [PMID:27154758]
  3. Ye H, et al.
    RD26 mediates crosstalk between drought and brassinosteroid signalling pathways.
    Nat Commun, 2017. 8: p. 14573
    [PMID:28233777]