PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010520449.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 311aa    MW: 35188.8 Da    PI: 4.833
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010520449.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.93.6e-48191442128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      pGf+F+Ptd el+++yLk+k++g +  + evi+evdiy++ePwdLp k++ + e+ew+fF +r +ky++g++++r+t++g+Wkatgk+++v+s 
  XP_010520449.1  19 FPGFKFSPTDTELISYYLKRKIDGMERCV-EVITEVDIYNFEPWDLPdKSIVKAETEWFFFYTRGRKYPHGSQNKRTTQKGFWKATGKERNVKS- 111
                     59************************777.99***************777778899**************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + e++g+k+tLvfy grapkge+t+W++hey +
  XP_010520449.1 112 GAEVIGTKRTLVFYVGRAPKGERTEWIIHEYCM 144
                     999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5112159IPR003441NAC domain
PROSITE profilePS5100550.67218160IPR003441NAC domain
PfamPF023651.6E-2320143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAGEISNETE KSLASATAFP GFKFSPTDTE LISYYLKRKI DGMERCVEVI TEVDIYNFEP  60
WDLPDKSIVK AETEWFFFYT RGRKYPHGSQ NKRTTQKGFW KATGKERNVK SGAEVIGTKR  120
TLVFYVGRAP KGERTEWIIH EYCMKGVPPD ALVVCRLRRN TEFQASSSEK TEPINDITES  180
AGQEPIDDIT ESAQDQAPID EDFYAEILRD DIVKLDEAVI QGKPETEIPR MQTEATASRV  240
LPLPNILDEE MKTVVQEELA PKTQGSPEHE RLSKCLLGSV KTVNRNRWFS GIAVVAVVVM  300
FINHLAWGGD D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-412014217138Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcription factor involved in modulation of abscisic acid (ABA) signaling. Attenuates ABA sensitivity and glucose-induced ABA accumulation. Reduces the expression of ABI4 gene. {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:24625790}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010520449.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By glucose (PubMed:24625790). Induced by salt, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:24625790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010520449.10.0PREDICTED: NAC domain-containing protein 60-like isoform X2
SwissprotQ9LXL91e-124NAC60_ARATH; NAC domain-containing protein 60
TrEMBLM4DY751e-124M4DY75_BRARP; Uncharacterized protein
STRINGXP_010520448.10.0(Tarenaya hassleriana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.11e-126NAC domain containing protein 60
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]