PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010520443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family NAC
Protein Properties Length: 243aa    MW: 27433.2 Da    PI: 9.9976
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010520443.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.63.2e-4251352127
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkklel.eevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +GfrF Pt++el+++yL++k+eg+ ++  ++vi+ vd++ veP++Lp+    ++++++++w+fF++r++++a+g r++r+t+sgyWkatg+  +
  XP_010520443.1   5 LVGFRFYPTEDELISFYLRNKLEGRVIPGmARVIPVVDVFAVEPNHLPQlageRCRGDTEQWFFFVPRQEREARGGRPSRTTASGYWKATGSPGP 99 
                     68************************7761556**************9656766666888*********************************** PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     v+s++++++g+kkt+vfy g+ap+g+kt+W m+ey+
  XP_010520443.1 100 VFSADNRVIGVKKTMVFYIGKAPTGRKTRWKMNEYK 135
                     ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-473161IPR003441NAC domain
PROSITE profilePS5100546.5494161IPR003441NAC domain
PfamPF023653.9E-236135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MDELLVGFRF YPTEDELISF YLRNKLEGRV IPGMARVIPV VDVFAVEPNH LPQLAGERCR  60
GDTEQWFFFV PRQEREARGG RPSRTTASGY WKATGSPGPV FSADNRVIGV KKTMVFYIGK  120
APTGRKTRWK MNEYKAIDGT ANMSPIPQLR HEFSLCRLYI TSGSSRAFDR RPMKAYQIEG  180
MLPRNGAGPS SQVRTMAGRA SSSETSYSRG DHADLPVNTA QTSPEMVDGL TKPFWEWEKL  240
NWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-30715918166Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010520443.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010520443.10.0PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR31e-118NAC90_ARATH; NAC domain-containing protein 90
TrEMBLV4KW251e-123V4KW25_EUTSA; Uncharacterized protein
STRINGXP_010520443.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-121NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]