PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010520402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family LBD
Protein Properties Length: 123aa    MW: 14280.5 Da    PI: 8.3728
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010520402.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601124e-3571061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk++ r+C++dC+l pyfp+++p++f++++ lFG+sn+ k+++++ ++ reda++s+ yeA  r   Pv+G++ vi++l+ q+ ++ ++l+
  XP_010520402.1   7 QCAACKYQHRRCTSDCILPPYFPEDEPETFKMARNLFGVSNIKKMIRDVAPHLREDAVRSIKYEALFRSMFPVHGCCLVINELSYQIIEATKQLS 101
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     l++++
  XP_010520402.1 102 LIQAQ 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.9136107IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-337104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MKRKREQCAA CKYQHRRCTS DCILPPYFPE DEPETFKMAR NLFGVSNIKK MIRDVAPHLR  60
EDAVRSIKYE ALFRSMFPVH GCCLVINELS YQIIEATKQL SLIQAQVEAR FQGEPSDDGR  120
PFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-23810712111LOB family transfactor Ramosa2.1
5ly0_B1e-23810712111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010520402.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010520402.13e-88PREDICTED: LOB domain-containing protein 25-like
TrEMBLA0A0A0KXA11e-29A0A0A0KXA1_CUCSA; Uncharacterized protein
STRINGXP_010520402.11e-87(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-30LOB domain-containing protein 25