PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010520350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 912aa    MW: 101614 Da    PI: 7.3091
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010520350.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.17.9e-24284385199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + ++
  XP_010520350.1 284 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyDKQ-RPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEN 375
                     99****************************96433.45679************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+++++r+
  XP_010520350.1 376 GELRLGIRRA 385
                     999****996 PP

2Auxin_resp116.62.1e-38409490182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+s ks+F+v+Y+Pra+++eF++++ek+++ + ++vs+G+Rf+m++e++d++e+r++G+v+g+sdldp+rWpnSkWr+L
  XP_010520350.1 409 VANAVSAKSMFHVFYSPRATHAEFIIPYEKYMACIGNPVSIGTRFRMRYEMDDCPEKRCTGVVTGISDLDPYRWPNSKWRCL 490
                     689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-41277398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-43277397IPR015300DNA-binding pseudobarrel domain
CDDcd100171.10E-22282384No hitNo description
PROSITE profilePS5086313.267284386IPR003340B3 DNA binding domain
PfamPF023629.1E-22284385IPR003340B3 DNA binding domain
SMARTSM010192.9E-24284386IPR003340B3 DNA binding domain
PfamPF065072.4E-32409490IPR010525Auxin response factor
PROSITE profilePS5174522.527784866IPR000270PB1 domain
SuperFamilySSF542774.51E-9788863No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 912 aa     Download sequence    Send to blast
MSGISSKNVI FFSGKGIEKD EDECRVGSVL SWLCLSPHLS HSLSPPNCLL FPFSFLLFFF  60
FFFDFFFHVC NCLRLFLLLP LLSTCKWRKK NHTLKPFSLF DAHASLSLSL TLSFMEFDLN  120
HEAASVGEKS DDGGGLVKGS SGNSPSSSSS CSSGLSSSSS ASASSIYSEL WHACAGPLTS  180
LPKKGNVVVY LPQGHLEQGA MVSSSAPLSP MDIPKFDLQP QIFCRVVNIR LLANKETDEV  240
YTQLTLLPQQ ELAVLNLEGK ELLELGGDGE RNGSLSTKQT PHMFCKTLTA SDTSTHGGFS  300
VPRRAAEDCF PPLDYDKQRP SQELVAKDLH GVEWRFRHIY RGQPRRHLLT TGWSIFVSQK  360
NLVSGDAVLF LRGENGELRL GIRRAARPRH GLPSSVIEQN SFSNILSLVA NAVSAKSMFH  420
VFYSPRATHA EFIIPYEKYM ACIGNPVSIG TRFRMRYEMD DCPEKRCTGV VTGISDLDPY  480
RWPNSKWRCL LVRWDESFMG DHQERISPWE MDPSVSLPPW TIQPSPRPKR SRIGLLNTPP  540
GNPIMERGAF LDFEELVRPS KVLQGQENIG FASHVHGCDV MNRRKLDITM QSHPNPVFVP  600
SGTMAKFDEF IDATTRAYSS VLDLDRFPRT LQGQEICSFR SLPQTAAFNA TASGATILGC  660
NNPFSFQSNR SSFYPLASQG FRSSGIPYHN LYNIGEEPSR RHCHMMSCPR ETGAVVNRVQ  720
NMGTQKESVL PEKVPTDSGL MTDMTNGQKD DDFNRKVPAG CKLFGFSLPA KTTASNPENS  780
SKRICTKKVH KQGSLVGRAI DLSRLNGYDD LITELERLFT MEGLLHDPDK GWRILYTDSE  840
NDMMVVGDDP WRDFCRVVAK IHIYTKEEVE KMNLGSINED NQSCLEEAAL MVEASKSSSV  900
SQPDSSPTIT RA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-11216951322354Auxin response factor 1
4ldw_A1e-11216951322354Auxin response factor 1
4ldw_B1e-11216951322354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010520350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010520350.10.0PREDICTED: auxin response factor 4 isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A087GCH40.0A0A087GCH4_ARAAL; Auxin response factor
STRINGXP_010520350.10.0(Tarenaya hassleriana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]